| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human VSIG4 is produced by our Mammalian expression system and the target gene encoding Arg20-Pro283 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 30 |
| UniProt number: |
Q9Y279 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CRIg (C-6His), VSIG4, V-Set Ig Domain Protein 4 |
| Short name: |
CRIg (C-6His), VSIG4, Recombinant V-Set Ig Domain- Protein 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CRIg (C-6His), V-set and immunoglobulin domain containing 4, sapiens V-Set and Ig Domain-Containing Protein 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CRIg and Z39IG, Plasma membranes, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, alternative pathway and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0032703 and negative regulation of interleukin-2 production and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006957 and complement activation, this GO :0005515 : protein binding, this GO :0005515 : protein binding, V-set and immunoglobulin domain containing 4 |
| Identity: |
17032 |
| Gene: |
VSIG4 |
More about : VSIG4 |
| Long gene name: |
V-set and immunoglobulin domain containing 4 |
| Synonyms: |
Z39IG |
| Locus: |
Xq12 |
| Discovery year: |
2004-09-10 |
| GenBank acession: |
AJ132502 |
| Entrez gene record: |
11326 |
| Pubmed identfication: |
11004523 17016555 17016562 |
| RefSeq identity: |
NM_007268 |
| Classification: |
V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000021727 |
| Locus Specific Databases: |
Mental Retardation database |