Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His)

Contact us
Catalog number: C548
Price: 785 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His)
Quantity: 100ul
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 24
UniProt number: Q96IQ7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VSIG2 (C-6His), V-Set Ig Domain Protein 2
Short name: VSIG2 (C-6His), Recombinant V-Set Ig Domain- Protein 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: V-set and immunoglobulin domain containing 2 (C-6His), sapiens V-Set and Ig Domain-Containing Protein 2, recombinant H
Alternative technique: rec
Alternative to gene target: 2210413P10Rik and CTH and CTXL, Plasma membranes, VSIG2 and IDBG-642611 and ENSBTAG00000022379 and 616943, VSIG2 and IDBG-75251 and ENSG00000019102 and 23584, Vsig2 and IDBG-150444 and ENSMUSG00000001943 and 57276, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0016020 and membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, V-set and immunoglobulin domain containing 2
Identity: 17149
Gene: VSIG2 | More about : VSIG2
Long gene name: V-set and immunoglobulin domain containing 2
Synonyms: CTXL CTH
Locus: 11q24, 2
Discovery year: 2004-09-02
GenBank acession: AF061022
Entrez gene record: 23584
Pubmed identfication: 9862345
RefSeq identity: NM_014312
Classification: I-set domain containing V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000150357

Related Products :

MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
C548 Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His) 10 µg 131 € novo human
GENTAUR-58bd5a31b804d Human V-set and immunoglobulin domain-containing protein 2 (VSIG2) 100ug 1663 € MBS Recombinant Proteins human
GENTAUR-58bd5a32194b3 Human V-set and immunoglobulin domain-containing protein 2 (VSIG2) 1000ug 1663 € MBS Recombinant Proteins human
GENTAUR-58bd5a3263430 Human V-set and immunoglobulin domain-containing protein 2 (VSIG2) 100ug 2177 € MBS Recombinant Proteins human
GENTAUR-58bd5a32ae7d3 Human V-set and immunoglobulin domain-containing protein 2 (VSIG2) 1000ug 2177 € MBS Recombinant Proteins human
DL-VSIG2-Hu Human V-Set And Immunoglobulin Domain Containing Protein 2 VSIG2 ELISA Kit 96T 974 € DL elisas human
MBS618274 VSIG2 (V-set and Ig Domain-containing Protein 2, CTM, CT-like Protein) Antibody 100ug 774 € MBS Polyclonals_1 human
EKU08195 V-Set And Immunoglobulin Domain Containing Protein 2 (VSIG2) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
MBS620170 SET7 (SET Domain Containing Protein 7, SET Domain-containing Protein 7, SET7/9, SET9, SETD7, FLJ21193, H3-K4-HMTase, H3 Lysine-4 Specific, Histone H3 K4 Methyltransferase, Histone H3-K4 Methyltransferase, Histone H3 Lysine 4 Specific Methyltransferase, Hi 100ul 785 € MBS Polyclonals_1 human
C549 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-6His) 10 µg 121 € novo human
CP78 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 1 mg 2283 € novo human
CJ71 Recombinant Human V-Set and Transmembrane Domain-Containing 1, VSTM1 (C-6His) 10 µg 156 € novo human
CI23 Recombinant Human V-Set and Transmembrane Domain-Containing 2A, VSTM2A (C-6His) 500 µg 1613 € novo human
CP79 Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 500 µg 1613 € novo mouse
MBS619444 FBXW7 (F-box and WD 40 Domain Protein 7, F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, F-box/WD-repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, Antibody 100ul 785 € MBS Polyclonals_1 drosophila
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
MBS614185 CLAN (CARD 12, CARD LRR and NACHT containing protein 1, CARD LRR and NACHT containing protein, Caspase recruitment domain containing protein 12, CLAN 1, CLAN A, CLAN, CLAN B, CLAN C, CLAN D, Clan protein, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR 2.1, CLR2.1 Antibody 100ug 575 € MBS Polyclonals_1 human
MBS615326 ARFBP1 (HUWE1. HECT, UBA and WWE domain containing 1, ARF-binding protein 1, ARF-BP1, E3 ubiquitin-protein ligase HUWE1, HECT, UBA and WWE domain-containing protein 1, HectH9, HECTH9, Homologous to E6AP carboxyl terminus homologous protein 9, HSPC272, Ib7 Antibody 100ug 569 € MBS Polyclonals_1 human
MBS623954 SETDB1, CT (Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, SET Domain Bifurcated 1, ERG-associated Protein with SET Domain, Histone-lysine N-methyltransferase SETDB1, Lysine N-methyltransferase 1E, ESET, KIAA0067, KMT1E) 200ul 603 € MBS Polyclonals_1 human
CD69 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-Fc) 50 µg 263 € novo human
CB41 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-Fc) 10 µg 156 € novo human
CH34 Recombinant Human Zinc Finger and BTB Domain-Containing Protein 9, ZBTB9 (C-6His) 10 µg 202 € novo human
abx263202 Anti-V-Set and Transmembrane Domain Containing 2 Like Protein (Recombinant) 100 µg 1543 € abbex human
MBS622587 SH2 domain protein 2A (SH2D2A, F2771, SCAP, SH2 domain-containing adapter protein, SH2 domain-containing protein 2A, T cell-specific adapter protein, TSAd, TSAD, VEGF receptor-associated protein, VRAP) 100ug 774 € MBS Polyclonals_1 human
MBS622108 GIPC3 (GIPC PDZ Domain Containing Family Member 3, PDZ Domain-containing Protein GIPC3, PDZ Domain Protein GIPC3) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
MBS619233 SH2D3A (SH2 Domain Containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) 100ug 591 € MBS Polyclonals_1 human
MBS620754 PLEKHB1 (Pleckstrin homology domain containing, family B (evectins) member 1, KPL1, PHR1, PHRET1, PH domain containing protein in retina 1, PH domain containing, retinal 1) 100ug 591 € MBS Polyclonals_1 human
MBS610920 NONO (Non Pou Domain Containing Octamer (ATGCAAAT) Binding Protein, Non-POU Domain-containing, Octamer-binding Protein, NonO Protein, 54kD Nuclear RNA and DNA Binding Protein, 55kD Nuclear Protein, DNA Binding p52/p100 Complex 52kD Subunit, HGNC:7871, NMT Antibody 100ul 785 € MBS Polyclonals_1 human