Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1, OLR1 (C-6His)

Contact us
Catalog number: C524
Price: 962 €
Supplier: DL elisas
Product name: Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1, OLR1 (C-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 131€ 50 µg 273€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LOX-1 is produced by our Mammalian expression system and the target gene encoding Ser61-Gln273 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 39 kD
UniProt number: P78380
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: OLR1 (C-6His), Oxidized Lipoprotein Receptor 1
Short name: OLR1 (C-6His), Recombinant Oxidized Low-Density Lipoprotein Receptor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: oxidized low density lipoprotein (lectin-like) receptor 1 (C-6His), sapiens Oxidized Low-Density Lipoprotein Receptor 1, recombinant H
Alternative technique: rec
Alternative to gene target: CLEC8A and LOX1 and LOXIN and SCARE1 and SLOX1, OLR1 and IDBG-18612 and ENSG00000173391 and 4973, OLR1 and IDBG-639562 and ENSBTAG00000004547 and 281368, Olr1 and IDBG-192019 and ENSMUSG00000030162 and 108078, carbohydrate binding, nuclei, this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006954 and inflammatory response and biological process this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0008015 and blood circulation and biological process this GO :0008219 and cell death and biological process this GO :0016020 and membrane and cellular component this GO :0030246 and carbohydrate binding and molecular function this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043235 and receptor complex and cellular component this GO :0045121 and membrane raft and cellular component this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005041 : low-density lipoprotein receptor activity, this GO :0005041 : low-density lipoprotein receptor activity and also this GO :0005515 : protein binding and also this GO :0030246 : carbohydrate binding, this GO :0005515 : protein binding, this GO :0030246 : carbohydrate binding, oxidized low density lipoprotein (lectin-like) receptor 1
Identity: 8133
Gene: OLR1 | More about : OLR1
Long gene name: oxidized low density lipoprotein receptor 1
Synonyms gene name: oxidised low density lipoprotein (lectin-like) receptor 1
Synonyms: LOX-1 SCARE1 CLEC8A
Locus: 12p13, 2
Discovery year: 1998-01-16
GenBank acession: D89050
Entrez gene record: 4973
Pubmed identfication: 9763655
RefSeq identity: NM_002543
Classification: Scavenger receptors C-type lectin domain family
Havana BLAST/BLAT: OTTHUMG00000168527

Related Products :

C524 Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1, OLR1 (C-6His) 1 mg 2283 € novo human
GENTAUR-58bcd7bb8aa32 Rat Oxidized low-density lipoprotein receptor 1 (Olr1) 100ug 1895 € MBS Recombinant Proteins rat
GENTAUR-58bcd7bbee259 Rat Oxidized low-density lipoprotein receptor 1 (Olr1) 1000ug 1895 € MBS Recombinant Proteins rat
GENTAUR-58bcd7bc6739f Rat Oxidized low-density lipoprotein receptor 1 (Olr1) 100ug 2409 € MBS Recombinant Proteins rat
GENTAUR-58bcd7bd2369c Rat Oxidized low-density lipoprotein receptor 1 (Olr1) 1000ug 2409 € MBS Recombinant Proteins rat
abx167794 Anti-Lectin Like Oxidized Low Density Lipoprotein Receptor 1 Protein (Recombinant) 10 μg 427 € abbex human
abx168011 Anti-Lectin Like Oxidized Low Density Lipoprotein Receptor 1 Protein (Recombinant) 50 μg 644 € abbex human
abx261492 Anti-Oxidized Low Density Lipoprotein Receptor 1 Protein (Recombinant) 1 mg 3559 € abbex human
abx250152 Anti-Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 ELISA Kit inquire 50 € abbex human
AE18202HU-48 ELISA test for Human Soluble lectin-like oxidized low density lipoprotein receptor-1 (sLOX-1) 1x plate of 48 wells 373 € abebio human
DL-LOX1-Hu Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 LOX1 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bd59628d360 human Oxidized low-density lipoprotein receptor 1 0.2 mg 564 € MBS Recombinant Proteins human
GENTAUR-58bd59640c363 human Oxidized low-density lipoprotein receptor 1 1000ug 1475 € MBS Recombinant Proteins human
GENTAUR-58bd596460e16 human Oxidized low-density lipoprotein receptor 1 0.05 mg 265 € MBS Recombinant Proteins human
GENTAUR-58bd5964a76de human Oxidized low-density lipoprotein receptor 1 0.5 mg 951 € MBS Recombinant Proteins human
AE18202HU Human Soluble lectin-like oxidized low density lipoprotein receptor-1 (sLOX-1) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE18202HU-96 Human Soluble lectin-like oxidized low density lipoprotein receptor-1 (sLOX-1) ELISA Kit 1x plate of 96 wells 612 € abebio human
abx129990 Anti-Lectin Like Oxidized Low Density Lipoprotein Receptor 1 Antibody inquire 50 € abbex human
abx254655 Anti-Mouse Oxidized low-density lipoprotein receptor 1 ELISA Kit inquire 50 € abbex mouse
abx257038 Anti-Rabbit Lectin Like Oxidized Low Density Lipoprotein Receptor 1 ELISA Kit inquire 50 € abbex human
abx255789 Anti-Rat Lectin Like Oxidized Low Density Lipoprotein Receptor 1 ELISA Kit inquire 50 € abbex rat
DL-LOX1-b Bovine Lectin Like Oxidized Low Density Lipoprotein Receptor 1 LOX1 ELISA Kit 96T 1020 € DL elisas bovine
EKU05575 Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human
EKU05576 Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU05577 Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA kit 1 plate of 96 wells 519 € Biomatik ELISA kits human
EKU05578 Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
EKU05579 Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
DL-LOX1-Mu Mouse Lectin Like Oxidized Low Density Lipoprotein Receptor 1 LOX1 ELISA Kit 96T 672 € DL elisas mouse
DL-LOX1-Rb Rabbit Lectin Like Oxidized Low Density Lipoprotein Receptor 1 LOX1 ELISA Kit 96T 962 € DL elisas human
DL-LOX1-Ra Rat Lectin Like Oxidized Low Density Lipoprotein Receptor 1 LOX1 ELISA Kit 96T 962 € DL elisas rat