Recombinant Human CD7, Leu-9 (C-6His)

Contact us
Catalog number: C516
Price: 340 €
Supplier: adi
Product name: Recombinant Human CD7, Leu-9 (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD7 is produced by our Mammalian expression system and the target gene encoding Ala26-Pro180 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 47 kD
UniProt number: P09564
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Leu-9 (C-6His), CD7
Short name: Leu-9 (C-6His), Recombinant CD7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: L-leucine-9 (C-6His), sapiens CD7 molecule, recombinant H
Alternative technique: rec
Alternative to gene target: CD7 and IDBG-642137 and ENSBTAG00000011359 and 510073, CD7 and IDBG-73437 and ENSG00000173762 and 924, Cd7 and IDBG-214932 and ENSMUSG00000025163 and 12516, GP40 and LEU-9 and Tp40 and TP41, Plasma membranes, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042110 and T cell activation and biological process this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD7 molecule
Identity: 1695
Gene: CD7 | More about : CD7
Long gene name: CD7 molecule
Synonyms gene name: CD7 antigen (p41)
Synonyms: GP40 LEU-9 TP41 Tp40
Synonyms name: p41 protein T-cell antigen CD7 T-cell leukemia antigen
Locus: 17q25, 3
Discovery year: 1986-01-01
GenBank acession: X06180
Entrez gene record: 924
Pubmed identfication: 1695199 3501369
RefSeq identity: NM_006137
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000178662

Related Products :

SP-89539-1 α-Helical CRF (9-41) [Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 (MW: 3826.44)] 1 mg 333 € adi human
SP-100829-1 Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5) 1 mg 260 € adi human
SP-52314-1 Urocortin, Human [H-Asp-Asn-Pro-Ser-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-THr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-Nh2; MW: 4696.3] 0,5 mg 340 € adi human
SP-89540-1 α-Helical CRF (12-41) [Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 (MW: 3497.08)] 1 mg 333 € adi human
SP-101335-1 TIP 39 (39 mer) (AA: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro)(MW: 4504.28) 1 mg 333 € adi human
SP-89720-1 [Tyr0]-Urocortin (rat) [Tyr-Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2; MW 4870.55] 1 mg 478 € adi human
SP-89721-1 Urocortin (rat) (free acid) (AA: Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val) (MW: 4708.35) 1 mg 478 € adi human
SP-55410-1 Urocortin, Rat [H-Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-THr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-THr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2; MW: 477.37] 0,5 mg 340 € adi rat
SP-101862-1 [Asn10,Leu11,D-Trp12]-pTH-Related Protein (7-34) amide (human, rat) [Leu-Leu-His-Asn-Leu-D-Trp-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2; MW: 3478.11] 1 mg 260 € adi human
SP-89535-1 Biotin-CRF (human, rat) (AA: Biotin-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2) (MW: 4983.85) 1 mg 623 € adi human
SP-89205-1 Biotin-Intermedin (human) (AA: Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2) (MW: 5329.14) 1 mg 333 € adi human
SP-101269-1 Biotin-Secretin, human (AA: Biotin-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2) (MW: 5465.80) 1 mg 260 € adi human
SP-52234-1 Corticotropin Releasing Factor, Human, Rat [H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Gly-Met-Ala-Arg-Ala-Gly-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-Nh2; MW: 4575.5] 0,5 mg 340 € adi rat
SP-81503-1 CRF (6-33) (human, rat) (AA: Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser) (MW: 3220.73) 1 mg 260 € adi human
SP-89159-1 Interleukin IL-1b (178-207) (human) (AA: Leu-Lys-Glu-Lys-Asn-Leu-Tyr-Leu-Ser-Cys-Val-Leu-Lys-Asp-Asp-Lys-Pro-Thr-Leu-Gln-Leu-Glu-Ser-Val-Asp-Pro-Lys-Asn-Tyr-Pro) (MW: 3492.07) 1 mg 260 € adi human
SP-52309-1 Secretin, Human [H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MW: 339.47] 1 mg 270 € adi human
SP-101329-1 Secretin-Lys(Biotin), human (AA: His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Lys(Biotin)) (MW: 3039.5) 1 mg 333 € adi human
SP-89718-1 Stresscopin-Related Peptide (6-43) (human) (AA: Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2) (MW: 4152.98) 1 mg 478 € adi human
SP-89709-1 Stresscopin-Related Peptide (free acid) (human) (AA: His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val) (MW: 4688.54) 1 mg 478 € adi human
SP-55419-1 Stresscopin-Related Peptide, Human [H-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MW: 4687.56] 0,5 mg 340 € adi human
SP-89536-1 Tyr-CRF (human, rat) (AA: Tyr-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2) (MW: 4920.73) 1 mg 478 € adi human
SP-89542-1 [Tyr0]-C-Peptide (human) [Tyr-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MW 3183.50] 1 mg 405 € adi human
SP-89719-1 [Tyr0]-Stresscopin-Related Peptide (human) [Tyr-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MW 4850.74] 1 mg 478 € adi human
SP-55417-1 Urocortin II, Human [H-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MW: 4449.31] 0,5 mg 456 € adi human
SP-89207-1 Biotin-Intermedin (rat) (AA: Biotin-Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2) (MW: 5445.29) 1 mg 333 € adi human
SP-55238-1 C-Peptide, Dogs [H-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Gly-Gly-Ala-Leu-Gln-OH; MW: 3174.54] 0,5 mg 340 € adi human
SP-55160-1 CKS-17 [H-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu-OH; MW: 1942.31] 0,5 mg 159 € adi human
SP-55412-1 Corticotropin Releasing Factor, Bovine [H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Gly-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2; MW: 4697.44] 0,5 mg 340 € adi bovine
SP-55413-1 Corticotropin Releasing Factor, ovine (AA: Leu-Asp-Leu-Thr-Phe-His-Leu -Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu- Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2) (MW: 4370.41) 1 mg 478 € adi human
SP-51419-1 Enfuvirtide (T-20) [CH3CO-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2; MW: 4462] 1 mg 340 € adi human