Recombinant Human Apolipoprotein A1, ApoA1 (C-6His)

Contact us
Catalog number: C511
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Apolipoprotein A1, ApoA1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apolipoprotein A-I is produced by our Mammalian expression system and the target gene encoding Arg19-Gln267 is expressed with a 6His tag at the C-terminus
Molecular Weight: 30 kD
UniProt number: P02647
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ApoA1 (C-6His), Apolipoprotein A1
Short name: ApoA1 (C-6His), Recombinant Apolipoprotein A1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: apolipoprotein A-I (C-6His), sapiens Apolipoprotein A1, recombinant H
Alternative technique: rec

Related Products :

C511 Recombinant Human Apolipoprotein A1, ApoA1 (C-6His) 50 µg 369 € novo human
CH52 Recombinant Human Apolipoprotein A1, ApoA1 (C-6His, E. coli) 1 mg 1115 € novo e-coli
CK19 Recombinant Human Apolipoprotein A-I, APOA1 500 µg 1186 € novo human
abx575180 Anti-Human Apolipoprotein A1 (APOA1) ELISA Kit inquire 50 € abbex human
GWB-71197B Apolipoprotein A-I (APOA1) Goat antibody to or anti-Human Polyclonal antibody 1 tube 602 € genways human
GWB-23F479 Apolipoprotein A-I (APOA1) Rabbit antibody to or anti-Human Polyclonal (aa188-199) antibody 1 x 1 vial 602 € genways human
MBS242063 Goat Polyclonal (IgG) to Human APOA1 / Apolipoprotein A 1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS243069 Goat Polyclonal (IgG) to Human APOA1 / Apolipoprotein A 1 Antibody 50ug 597 € MBS Polyclonals_1 human
DL-APOA1-Hu Human Apolipoprotein A1 APOA1 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bde61d4ab2a Mouse Monoclonal [clone 057-10029] (IgG2a,k) to Human APOA1 / Apolipoprotein A 1 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde863cec60 Mouse Monoclonal [clone 464CT10.4.4] (IgG1) to Human APOA1 / Apolipoprotein A 1 Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde86774d8c Mouse Monoclonal [clone AT1E12] (IgG1,k) to Human APOA1 / Apolipoprotein A 1 Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58b9d701f3733 Anas platyrhynchos Apolipoprotein A-I (APOA1) 100ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b9d7026ec73 Anas platyrhynchos Apolipoprotein A-I (APOA1) 1000ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b9d702d3a27 Anas platyrhynchos Apolipoprotein A-I (APOA1) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b9d70354f47 Anas platyrhynchos Apolipoprotein A-I (APOA1) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bdc15103548 Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc15167631 Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 404 € MBS Polyclonals human
GENTAUR-58bdc1ebb0642 Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc1f1b665f Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc1f21550f Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc5370e87f Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 619 € MBS Polyclonals human
GENTAUR-58bdc72c376da Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 420 € MBS Polyclonals human
GENTAUR-58bdc72ca91d0 Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 337 € MBS Polyclonals human
GENTAUR-58bdc7871797e Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdc9729befb Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcc0d6135e Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 343 € MBS Polyclonals human
GENTAUR-58bdcc0dc8bbb Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcc1f2700d Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcc1f94bd2 Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 520 € MBS Polyclonals human