Recombinant Human β-Galactoside α-2,6-Sialyltransferase 1, ST6GAL1 (C-6His)

Contact us
Catalog number: C500
Price: 2459 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human β-Galactoside α-2,6-Sialyltransferase 1, ST6GAL1 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ST6GAL1 is produced by our Mammalian expression system and the target gene encoding Lys27-Cys406 is expressed with a 6His tag at the C-terminus
Molecular Weight: 44, 6 kD
UniProt number: P15907
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ST6GAL1 (C-6His), &beta, -2, -Galactoside &alpha, 6-Sialyltransferase 1
Short name: ST6GAL1 (C-6His), -2, -Galactoside &alpha, 6-Sialyltransferase 1, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: ST6GAL1 (C-6His), sapiens &beta, -2, -Galactoside &alpha, 6-Sialyltransferase 1, recombinant H
Alternative technique: rec
Identity: 10860
Gene: ST6GAL1 | More about : ST6GAL1
Long gene name: ST6 beta-galactoside alpha-2, 6-sialyltransferase 1
Synonyms gene: SIAT1
Synonyms gene name: sialyltransferase 1 (beta-galactoside alpha-2, 6-sialyltranferase 1 ST6 N-acetylgalactosaminide alpha-2, 6-sialyltransferase 1 , 6-sialytransferase) ST6 beta-galactosamide alpha-2
Synonyms name: ST6Gal I
Locus: 3q27, 3
Discovery year: 1992-04-10
GenBank acession: X62822
Entrez gene record: 6480
Pubmed identfication: 2408023
RefSeq identity: NM_173216
Classification: Sialyltransferases
Havana BLAST/BLAT: OTTHUMG00000156500

Related Products :

C500 Recombinant Human β-Galactoside α-2,6-Sialyltransferase 1, ST6GAL1 (C-6His) 500 µg 1613 € novo human
abx251621 Anti-Human beta galactoside alpha 2,6-sialyltransferase 1 ELISA Kit 96 tests 659 € abbex human
GENTAUR-58b872bd44444 Bovine Beta-galactoside alpha-2,6-sialyltransferase 2 (ST6GAL2) 1000ug 2315 € MBS Recombinant Proteins bovine
GENTAUR-58b872bda8ebb Bovine Beta-galactoside alpha-2,6-sialyltransferase 2 (ST6GAL2) 1000ug 2824 € MBS Recombinant Proteins bovine
GENTAUR-58b892bfc05ac Pan troglodytes CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (ST3GAL3) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b892c02d581 Pan troglodytes CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (ST3GAL3) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b892c073101 Pan troglodytes CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (ST3GAL3) 100ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b892c104b90 Pan troglodytes CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (ST3GAL3) 1000ug 2575 € MBS Recombinant Proteins human
C682 Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase, ST8SIA1 (C-6His) 500 µg 1613 € novo human
MBS619555 Galectin-1 (GAL1, LGALS1, GAL-1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, 14kD lectin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620576 Galectin-1 (GAL1, LGALS1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) (Biotin) Antibody 50ug 597 € MBS Polyclonals_1 human
C667 Recombinant Human ST6 Sialyltransferase 2, ST6GalNAc2 (C-6His) 10 µg 202 € novo human
GENTAUR-58bc3df36b138 Human Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase (ST8SIA3) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bc3df3bcc7f Human Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase (ST8SIA3) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bafb1e6c5d6 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bafb1eb4432 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bafb1f094e0 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 100ug 2569 € MBS Recombinant Proteins human
GENTAUR-58bafb1f3db32 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 1000ug 2569 € MBS Recombinant Proteins human
GENTAUR-58bb276c4fe65 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bb276c9c67f CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bb276cd412e CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 100ug 2569 € MBS Recombinant Proteins human
GENTAUR-58bb276d32ee1 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase (lst) 1000ug 2569 € MBS Recombinant Proteins human
GENTAUR-58bd7775f2f9a Mouse CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 (St3gal2) 100ug 2000 € MBS Recombinant Proteins mouse
GENTAUR-58bd77764b95b Mouse CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 (St3gal2) 1000ug 2000 € MBS Recombinant Proteins mouse
GENTAUR-58bd77769760d Mouse CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 (St3gal2) 100ug 2514 € MBS Recombinant Proteins mouse
GENTAUR-58bd7776dea2b Mouse CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 (St3gal2) 1000ug 2514 € MBS Recombinant Proteins mouse
GENTAUR-58baf54320114 Pan troglodytes CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (ST3GAL4) 100ug 1945 € MBS Recombinant Proteins human
GENTAUR-58baf54376aeb Pan troglodytes CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (ST3GAL4) 1000ug 1945 € MBS Recombinant Proteins human
GENTAUR-58baf543c276b Pan troglodytes CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (ST3GAL4) 100ug 2459 € MBS Recombinant Proteins human
GENTAUR-58baf54418ca9 Pan troglodytes CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (ST3GAL4) 1000ug 2459 € MBS Recombinant Proteins human