| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Vascular Endothelial Growth Factor D is produced by our Mammalian expression system and the target gene encoding Phe93-Ser201 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 18 kD |
| UniProt number: |
O43915 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FIGF (C-6His), VEGF-D |
| Short name: |
FIGF (C-6His), Recombinant VEGF-D |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
c-FBJ murine osteosarcoma viral oncogene homolog induced growth factor (vascular endothelial growth factor D) (C-6His), sapiens VEGF-D, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, FIGF and IDBG-46123 and ENSG00000165197 and 2277, FIGF and IDBG-638939 and ENSBTAG00000009476 and 286799, Figf and IDBG-184806 and ENSMUSG00000031380 and 14205, VEGF-D and VEGFD, this GO :0001525 and angiogenesis and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005161 and platelet-derived growth factor receptor binding and molecular function this GO :0005172 and vascular endothelial growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0030154 and cell differentiation and biological process this GO :0030168 and platelet activation and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0042056 and chemoattractant activity and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043185 and vascular endothelial growth factor receptor 3 binding and molecular function this GO :0048010 and vascular endothelial growth factor receptor signaling pathway and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0060754 and positive regulation of mast cell chemotaxis and biological process, this GO :0005161 : platelet-derived growth factor receptor binding, this GO :0005161 : platelet-derived growth factor receptor binding and also this GO :0005172 : vascular endothelial growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0042056 : chemoattractant activity and also this GO :0042803 : protein homodimerization activity and also this GO :0043185 : vascular endothelial growth factor receptor 3 binding, this GO :0005172 : vascular endothelial growth factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0042056 : chemoattractant activity, this GO :0042803 : protein homodimerization activity, this GO :0043185 : vascular endothelial growth factor receptor 3 binding, vascular endothelial growth factor receptor 3 binding, c-fos induced growth factor (vascular endothelial growth factor D) |
| Identity: |
3708 |
| Gene: |
VEGFD |
More about : VEGFD |
| Long gene name: |
vascular endothelial growth factor D |
| Synonyms gene: |
FIGF |
| Synonyms gene name: |
c-fos induced growth factor (vascular endothelial growth factor D) |
| Synonyms: |
VEGF-D |
| Locus: |
Xp22, 2 |
| Discovery year: |
1997-03-27 |
| GenBank acession: |
AJ000185 |
| Entrez gene record: |
2277 |
| Pubmed identfication: |
9479493 |
| RefSeq identity: |
NM_004469 |
| Classification: |
VEGF family |
| Havana BLAST/BLAT: |
OTTHUMG00000021175 |
| Locus Specific Databases: |
Mental Retardation database |