Recombinant Human Ephrin-A4, EFNA4 (C-Fc-6His)

Contact us
Catalog number: C480
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Ephrin-A4, EFNA4 (C-Fc-6His)
Quantity: 1 mg
Other quantities: 1 mg 506€ 10 µg 100€ 50 µg 156€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human Ephrin-A4 is produced by our Mammalian expression system and the target gene encoding Leu26-Gly171 is expressed with a Fc
Molecular Weight: 3 kD, 44
UniProt number: P52798
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EFNA4 (C-Fc-6His), Ephrin-A4
Short name: EFNA4 (C-Fc-6His), Recombinant Ephrin-A4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EFNA4 (C-fragment c-6His), sapiens Ephrin-A4, recombinant H
Alternative technique: rec
Identity: 3224
Gene: EFNA4 | More about : EFNA4
Long gene name: ephrin A4
Synonyms gene: EPLG4
Synonyms gene name: ephrin-A4
Synonyms: LERK4
Locus: 1q21, 3
Discovery year: 1995-01-17
GenBank acession: AJ006352
Entrez gene record: 1945
Pubmed identfication: 8660976
RefSeq identity: NM_005227
Classification: Ephrins
Havana BLAST/BLAT: OTTHUMG00000035309

Related Products :

C466 Recombinant Human Ephrin-A4, EFNA4 (C-6His) 50 µg 212 € novo human
C480 Recombinant Human Ephrin-A4, EFNA4 (C-Fc-6His) 1 mg 506 € novo human
CC50 Recombinant Mouse Ephrin-A4, EFNA4 (C-Fc) 1 mg 1014 € novo mouse
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS610892 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS613613 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
abx572534 Anti-Human Ephrin A4 (EFNA4) ELISA Kit 96 tests 789 € abbex human
DL-EFNA4-Hu Human Ephrin A4 EFNA4 ELISA Kit 96T 904 € DL elisas human
MBS248974 PAb (IgG) to Human EFNA4 / Ephrin A4 Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bdc38c166b2 Anti- Ephrin A4 (EFNA4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc38c51b4b Anti- Ephrin A4 (EFNA4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc3e4bab6f Anti- Ephrin A4 (EFNA4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc3e56ba11 Anti- Ephrin A4 (EFNA4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcfe0205cb Anti- Ephrin A4 (EFNA4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdcfe0880b8 Anti- Ephrin A4 (EFNA4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd18111c85 Anti- Ephrin A4 (EFNA4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd1c8a828e Anti- Ephrin A4 (EFNA4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd2ad41f18 Anti- Ephrin A4 (EFNA4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd49b68e85 Anti- Ephrin A4 (EFNA4) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd7fb51cd3 Anti- Ephrin A4 (EFNA4) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddbfd53ff3 Anti- Ephrin A4 (EFNA4) Antibody 100ug 603 € MBS Polyclonals human
MBS616819 Ephrin A4 (EFNA4) Antibody 100ug 663 € MBS Polyclonals_1 human
EKU03922 Ephrin A4 (EFNA4) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
CS02 Recombinant Human Ephrin A Receptor 1, EphA1 (Lys26-Glu547, C-6His) 50 µg 303 € novo human
CS03 Recombinant Human Ephrin A Receptor 2, EphA2 (C-6His) 50 µg 202 € novo human
C519 Recombinant Human Ephrin A Receptor 7, EphA7 (C-6His) 10 µg 141 € novo human
CA70 Recombinant Human Ephrin-A1, EFNA1, LERK-1 (C-6His) 10 µg 156 € novo human
C464 Recombinant Human Ephrin-A3, EFNA3(C-6His) 50 µg 131 € novo human
C871 Recombinant Human Ephrin B Receptor 1, EphB1 (ICD, C-6His) 1 mg 2283 € novo human