Recombinant Human GDNF Receptor α-2, GFRA2 (C-6His)

Contact us
Catalog number: C472
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human GDNF Receptor α-2, GFRA2 (C-6His)
Quantity: 0.12 ml
Other quantities: 1 mg 1166€ 10 µg 90€ 500 µg 831€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GDNF Family Receptor alpha-2 is produced by our Mammalian expression system and the target gene encoding Ser22-Ser441 is expressed with a 6His tag at the C-terminus
Molecular Weight: 47, 79 kD
UniProt number: O00451
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GFRA2 (C-6His), -2, GDNF Receptor &alpha
Short name: GFRA2 (C-6His), -2, Recombinant GDNF Receptor &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: GFRA2 (C-6His), sapiens glial cell derived neurotrophic factor Receptor &alpha, -2, recombinant H
Alternative technique: rec
Alternative to gene target: ATF1 and ATF2 and HFB1-GDNF and HSCR3, BT, Extracellular, GDNF and IDBG-17169 and ENSG00000168621 and 2668, Gdnf and IDBG-128378 and ENSMUSG00000022144 and 14573, protein homodimerization activity, this GO :0001656 and metanephros development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001759 and organ induction and biological process this GO :0001941 and postsynaptic membrane organization and biological process this GO :0003337 and mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0021784 and postganglionic parasympathetic nervous system development and biological process this GO :0030432 and peristalsis and biological process this GO :0031175 and neuron projection development and biological process this GO :0032770 and positive regulation of monooxygenase activity and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048255 and mRNA stabilization and biological process this GO :0048484 and enteric nervous system development and biological process this GO :0048485 and sympathetic nervous system development and biological process this GO :0051584 and regulation of dopamine uptake involved in synaptic transmission and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060688 and regulation of morphogenesis of a branching structure and biological process this GO :0072107 and positive regulation of ureteric bud formation and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, 58072 and IDBG-630047 and ENSBTAG00000005176 and 386587, glial cell derived neurotrophic factor
Identity: 4244
Gene: GFRA2 | More about : GFRA2
Long gene name: GDNF family receptor alpha 2
Synonyms: RETL2 GDNFRB NTNRA TRNR2
Locus: 8p21, 3
Discovery year: 1997-10-21
GenBank acession: AF002700
Entrez gene record: 2675
Pubmed identfication: 9177201
RefSeq identity: NM_001495
Havana BLAST/BLAT: OTTHUMG00000163897

Related Products :

C472 Recombinant Human GDNF Receptor α-2, GFRA2 (C-6His) 10 µg 90 € novo human
CJ30 Recombinant Human GDNF Receptor α-2, GFRA2 (C-Fc-6His) 10 µg 100 € novo human
MBS622722 GFR alpha1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1, GDNF Family Receptor alpha 1, GDNF Receptor alpha 1, GFR-alpha-1, GFRalpha1, GFRA1, GDNF Receptor alpha, GDNFR alpha, GDNFR-alpha, GDNFRa, GDNFR, GPI-linked Anchor Protein, MGC23045 Antibody 100ug 857 € MBS Polyclonals_1 human
GENTAUR-58bca28cbb4f8 Human GDNF family receptor alpha-2 (GFRA2) 100ug 2188 € MBS Recombinant Proteins human
GENTAUR-58bca28d0cdb5 Human GDNF family receptor alpha-2 (GFRA2) 1000ug 2188 € MBS Recombinant Proteins human
GENTAUR-58bca28d5423d Human GDNF family receptor alpha-2 (GFRA2) 100ug 2702 € MBS Recombinant Proteins human
GENTAUR-58bca28d8b740 Human GDNF family receptor alpha-2 (GFRA2) 1000ug 2702 € MBS Recombinant Proteins human
C471 Recombinant Human GDNF Family Receptor α-1, GFRA1 (C-6His) 10 µg 90 € novo human
CD08 Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF (C-Fc-6His) 10 µg 156 € novo human
RP-0740H Recombinant Human GFRA2 / GDNFRB Protein (His Tag) 100μg 624 € adv human
CD55 Recombinant Human GDNF Family Receptor α-1, GFRA1 (C-Fc) 1 mg 1115 € novo human
RP-1307M Recombinant Mouse GFRA2 / GFRα2 / GDNFRB Protein (His Tag) 100μg 659 € adv human
MBS615826 GFRa2 (GFRalpha2, Neurturin Receptor) Antibody 100ug 608 € MBS Polyclonals_1 human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
abx260723 Anti-GDNF Family Receptor alpha 3 Protein (Recombinant) 20 µg 340 € abbex human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
LV168407 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV168408 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV168409 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV168410 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV168412 GFRA2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV168411 GFRA2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx251581 Anti-Human GDNF family receptor alpha 1 ELISA Kit 96 tests 659 € abbex human
GENTAUR-58b8a1aab1254 Human GDNF family receptor alpha-3 (GFRA3) 100ug 1978 € MBS Recombinant Proteins human
GENTAUR-58b8a1aaeed9e Human GDNF family receptor alpha-3 (GFRA3) 1000ug 1978 € MBS Recombinant Proteins human
GENTAUR-58b8a1abb7ada Human GDNF family receptor alpha-3 (GFRA3) 100ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b8a1ac3795b Human GDNF family receptor alpha-3 (GFRA3) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58bdea5890dfb Anti- GFRA2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdea58e69ff Anti- GFRA2 Antibody 0.12 ml 348 € MBS Polyclonals human