Recombinant Human Chymotrypsin-Like Protease CTRL-1, CTRL (C-6His)

Contact us
Catalog number: C458
Price: 2232 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Chymotrypsin-Like Protease CTRL-1, CTRL (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CTRL is produced by our Mammalian expression system and the target gene encoding Cys19-Asn264 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15 kD, 27
UniProt number: P40313
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTRL (C-6His), Chymotrypsin-Like Protease CTRL-1
Short name: CTRL (C-6His), Recombinant Chymotrypsin-Like Protease CTRL-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CTRL (C-6His), sapiens Chymotrypsin-Like Protease CTRL-1, recombinant H
Alternative technique: rec
Identity: 2524
Gene: CTRL | More about : CTRL
Long gene name: chymotrypsin like
Synonyms gene name: chymotrypsin-like
Locus: 16q22, 1
Discovery year: 1993-07-29
Entrez gene record: 1506
Pubmed identfication: 8268911
Havana BLAST/BLAT: OTTHUMG00000137552

Related Products :

C458 Recombinant Human Chymotrypsin-Like Protease CTRL-1, CTRL (C-6His) 1 mg 2283 € novo human
RP-0512H Recombinant Human CTRL-1 / CTRL / Chymotrypsin-like protease Protein (His Tag) 20μg 572 € adv human
CA31 Recombinant Human Chymotrypsin-Like Elastase Family Member 3A, CELA3A (C-6His) 500 µg 1613 € novo human
C518 Recombinant Human Chymotrypsin-C, CTRC (C-6His) 10 µg 202 € novo human
GENTAUR-58bc6ad1bdcf7 Macrovipera lebetina Chymotrypsin-like protease VLCTLP 100ug 1702 € MBS Recombinant Proteins human
GENTAUR-58bc6ad2119ca Macrovipera lebetina Chymotrypsin-like protease VLCTLP 1000ug 1702 € MBS Recombinant Proteins human
GENTAUR-58bc6ad25bb4d Macrovipera lebetina Chymotrypsin-like protease VLCTLP 100ug 2210 € MBS Recombinant Proteins human
GENTAUR-58bc6ad29747c Macrovipera lebetina Chymotrypsin-like protease VLCTLP 1000ug 2210 € MBS Recombinant Proteins human
LV129773 CTRL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV129774 CTRL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV129775 CTRL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV129776 CTRL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV129778 CTRL Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV129777 CTRL Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be09ef64c5e Anti- CTRL Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be09efba98d Anti- CTRL Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be42a492071 Anti- CTRL Antibody 100ug 393 € MBS Polyclonals human
abx913129 Anti-CTRL siRNA inquire 50 € abbex human
86-1072C CO2 Cylinder Changeover Ctrl 1 Control/Unit 1496 € Genesee 02 human
GWB-E2FE76 CTRL antibody 1 vial 486 € genways human
GWB-ML703A CTRL antibody 1 vial 521 € genways human
GWB-9697D9 CTRL Over-expression Lysate reagent 1 vial 463 € genways human
C821 Recombinant Human Airway Trypsin-Like Protease 5, HATL5, TMPRSS11B (C-6His) 1 mg 2283 € novo human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623159 USP18 (Ubiquitin Specific Protease 18, Ubiquitin-specific Protease 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Carboxyl-terminal Hydrolase 18, Ubl Thioesterase 18) 100ug 829 € MBS Polyclonals_1 human
RP-0511H Recombinant Human CTRC / chymotrypsin C Protein (His Tag) 10μg 624 € adv human
abx250950 Anti-Human Chymotrypsin-like elastase family member 1 ELISA Kit inquire 50 € abbex human
GENTAUR-58b8fdf140054 Human Chymotrypsin-like elastase family member 2A (CELA2A) 100ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b8fdf1a88d2 Human Chymotrypsin-like elastase family member 2A (CELA2A) 1000ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b8fdf2141a0 Human Chymotrypsin-like elastase family member 2A (CELA2A) 100ug 2232 € MBS Recombinant Proteins human