Recombinant Human CLEC3B, Tetranectin (C-6His)

Contact us
Catalog number: C453
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human CLEC3B, Tetranectin (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CLEC3B is produced by our Mammalian expression system and the target gene encoding Glu22-Val202 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 21 kD
UniProt number: P05452
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Tetranectin (C-6His), CLEC3B
Short name: Tetranectin (C-6His), Recombinant CLEC3B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Tetranectin (C-6His), sapiens CLEC3B, recombinant H
Alternative technique: rec
Identity: 11891
Gene: CLEC3B | More about : CLEC3B
Long gene name: C-type lectin domain family 3 member B
Synonyms gene: TNA
Synonyms gene name: member B , tetranectin (plasminogen binding protein) C-type lectin domain family 3
Synonyms: TN
Locus: 3p21, 31
Discovery year: 1993-08-26
Entrez gene record: 7123
RefSeq identity: NM_003278
Classification: C-type lectin domain family
Havana BLAST/BLAT: OTTHUMG00000133087

Related Products :

C453 Recombinant Human CLEC3B, Tetranectin (C-6His) 1 mg 2283 € novo human
RP-1194M Recombinant Mouse CLEC3B / Tetranectin Protein (His Tag) 50μg 624 € adv mouse
101-M715 Anti-Human Tetranectin 100ug 336 € Reliatech antibodies human
abx252170 Anti-Human Tetranectin ELISA Kit 96 tests 659 € abbex human
CEK1329 anti-Human Tetranectin ELISA Kit Antibody 96 Tests 703 € acr human
HYB130-10 Tetranectin, a.a. 17-181, Clone: 130-10, Mouse Monoclonal antibody-Human; WB/No ELISA/No IH 0.2mg Ask price € accurate-monoclonals human
HYB130-11 Tetranectin, a.a. 17-181, Clone: 130-11, Mouse Monoclonal antibody-Human; WB/ELISA/IH 0.2mg 1234 € accurate-monoclonals human
HYB130-12 Tetranectin, a.a. 17-181, Clone: 130-12, Mouse Monoclonal antibody-Human; WB/ELISA/IH 0.2mg Ask price € accurate-monoclonals human
HYB130-13 Tetranectin, a.a. 17-181, Clone: 130-13, Mouse Monoclonal antibody-Human; WB/ELISA/No IH 0.2mg 1234 € accurate-monoclonals human
HYB130-14 Tetranectin, a.a. 17-181, Clone: 130-14, Mouse Monoclonal antibody-Human; WBELISA/No IH 0.2mg 1234 € accurate-monoclonals human
MEDCLA774 Tetranectin, Clone: 11F1, Mouse Monoclonal antibody-Human; paraffin/NO frozen, IH/No WB 1000ul 1199 € accurate-monoclonals human
abx151093 Anti-Human CLEC3B ELISA Kit 96 tests 992 € abbex human
abx571949 Anti-Human CLEC3B ELISA Kit 96 tests 847 € abbex human
LV120499 CLEC3B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV120500 CLEC3B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV120501 CLEC3B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV120502 CLEC3B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV120504 CLEC3B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV120503 CLEC3B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
DL-CLEC3B-Hu Human C-Type Lectin Domain Family 3, Member B CLEC3B ELISA Kit 96T 974 € DL elisas human
abx225113 Anti-Tetranectin Antibody 200 μl 514 € abbex human
GENTAUR-58be648db51fe Anti-Tetranectin (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-6413R-A350 Tetranectin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6413R-A488 Tetranectin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6413R-A555 Tetranectin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6413R-A594 Tetranectin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6413R-A647 Tetranectin Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6413R-Biotin Tetranectin Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6413R Tetranectin Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-6413R-Cy3 Tetranectin Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human