Recombinant Human Fc γ RIIb, CD32b (C-6His)

Contact us
Catalog number: C444
Price: 485 €
Supplier: acr
Product name: Recombinant Human Fc γ RIIb, CD32b (C-6His)
Quantity: 20 Вµg
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Fc-gamma RIIb is produced by our Mammalian expression system and the target gene encoding Thr43-Pro217 is expressed with a 6His tag at the C-terminus
Molecular Weight: 20, 64 kD
UniProt number: P31994
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD32b (C-6His), RIIb, Fc &gamma
Short name: CD32b (C-6His), RIIb, Recombinant Fc &gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CD32b (C-6His), RIIb, sapiens fragment c &gamma, recombinant H
Alternative technique: rec

Related Products :

C444 Recombinant Human Fc γ RIIb, CD32b (C-6His) 10 µg 131 € novo human
GENTAUR-58b87384afb9b Enterobacteria phage T4 Protein rIIB (rIIB) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58b873850171f Enterobacteria phage T4 Protein rIIB (rIIB) 1000ug 1901 € MBS Recombinant Proteins human
GENTAUR-58b873854789b Enterobacteria phage T4 Protein rIIB (rIIB) 100ug 2415 € MBS Recombinant Proteins human
GENTAUR-58b87385b9176 Enterobacteria phage T4 Protein rIIB (rIIB) 1000ug 2415 € MBS Recombinant Proteins human
C767 Recombinant Mouse Fc γ RII, CD32b, FCGR2 (C-6His) 50 µg 303 € novo human
MBS624493 FCGR2B (CD32, Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, CD32, FCG2, IGFR2) Antibody 50ug 619 € MBS Polyclonals_1 human
C302 Recombinant Human Activin Receptor 2B, Activin RIIB, ACVR2B (C-6His) 500 µg 1186 € novo human
CD58 Recombinant Human Activin Receptor 2B, Activin RIIB, ACVR2B (C-Fc-6His) 10 µg 100 € novo human
MBS620042 Tubulin, gamma (TUBG, Tubulin gamma 1 Chain, TUBG1, Tubulin gamma 2 Chain, TUBG2, Gamma 1 Tubulin, Gamma 2 Tubulin, Gamma Tubulin 1, Gamma Tubulin 2, Gamma Tubulin Complex Component 1, GCP 1, GCP-1, MGC131994, Xgam) (Cy3) Antibody 100ul 696 € MBS Polyclonals_1 human
RP-1685H Recombinant Human CD32b / FCGR2B Protein (His & AVI Tag), Biotinylated 20μg 624 € adv human
RP-0317H Recombinant Human CD32b / FCGR2B Protein (His Tag) 50μg 624 € adv human
RP-1185RC Recombinant Cynomolgus CD32b / FCGR2B Protein (His & AVI Tag), Biotinylated 50μg 659 € adv human
RP-1181RC Recombinant Cynomolgus CD32b / FCGR2B Protein (His Tag) 50μg 659 € adv human
RP-2047R Recombinant Rat CD32b / FCGR2B Protein (His Tag) 50μg 659 € adv rat
MBS621355 Activin Receptor Type IIB (RIIB) 100ug 774 € MBS Polyclonals_1 human
MBS621317 Activin Receptor Type IIB (RIIB) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
GENTAUR-58bd0ddc7e102 Enterobacteria phage T4 Uncharacterized 7.5 kDa protein in denB-rIIB intergenic region (y16Q) 100ug 1271 € MBS Recombinant Proteins human
GENTAUR-58bd0ddcbc5cb Enterobacteria phage T4 Uncharacterized 7.5 kDa protein in denB-rIIB intergenic region (y16Q) 1000ug 1271 € MBS Recombinant Proteins human
GENTAUR-58bd0ddd13cde Enterobacteria phage T4 Uncharacterized 7.5 kDa protein in denB-rIIB intergenic region (y16Q) 100ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bd0ddd5e02c Enterobacteria phage T4 Uncharacterized 7.5 kDa protein in denB-rIIB intergenic region (y16Q) 1000ug 1779 € MBS Recombinant Proteins human
MBS620030 Protein Kinase A, RegII beta, (PKA RIIb) Antibody 5 Vials 658 € MBS Polyclonals_1 human
MBS610081 Protein Kinase A, RII beta, phosphorylated (Ser114) (PKA RIIb) Antibody 10 Blots 663 € MBS Polyclonals_1 human
MBS613269 Protein Kinase A, RII beta, phosphorylated (Ser114) (PKA RIIb) Antibody 100ul 674 € MBS Polyclonals_1 human
MBS551007 Anti-Human CD32b (FcgRIIB) Polyclonal 200ug 475 € MBS Polyclonals_1 human
MBS551007 Anti-Human CD32b (FcgRIIB) Polyclonal Antibody 100ug 359 € MBS Polyclonals_1 human
MBS247259 Goat Polyclonal to Human CD32B Antibody 50ug 597 € MBS Polyclonals_1 human
MBS551216 Human CD32b Affinity Purified Polyclonal Antibody 200ug 724 € MBS Polyclonals_1 human
AR50646PU-N anti-CD32B (46-217, His-tag) Antibody 0,1 mg 1109 € acr human
AR50646PU-S anti-CD32B (46-217, His-tag) Antibody 20 Вµg 485 € acr human