Recombinant Human Apolipoprotein H, ApoH (C-6His)

Contact us
Catalog number: C432
Price: 764 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Apolipoprotein H, ApoH (C-6His)
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apolipoprotein H is produced by our Mammalian expression system and the target gene encoding Gly20-Ser345 is expressed with a 6His tag at the C-terminus
Molecular Weight: 29 kD, 37
UniProt number: P02749
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ApoH (C-6His), Apolipoprotein H
Short name: ApoH (C-6His), Recombinant Apolipoprotein H
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: apolipoprotein H (beta-2-glycoprotein I) (C-6His), sapiens Apolipoprotein H, recombinant H
Alternative technique: rec

Related Products :

C432 Recombinant Human Apolipoprotein H, ApoH (C-6His) 500 µg 1613 € novo human
B2GP16-R-25 Recombinant (E.Coli, His-tag, 20-345 aa) human beta-2 glycoprotein (B2-GP or Apolipoprotein H/ApoH) protein (>95% pure, ~39 kda) 25 μg 405 € adi human
RP-0083H Recombinant Human Apolipoprotein H / APOH Protein (His Tag) 50μg 572 € adv human
abx572183 Anti-Human Apolipoprotein H (APOH) ELISA Kit inquire 50 € abbex human
MBS242583 Goat Polyclonal (IgG) to Human APOH / Apolipoprotein H Antibody 50ug 597 € MBS Polyclonals_1 human
MBS244891 Goat Polyclonal (IgG) to Human APOH / Apolipoprotein H Antibody 0.25 miligrams 597 € MBS Polyclonals_1 human
DL-APOH-Hu Human Apolipoprotein H APOH ELISA Kit 96T 846 € DL elisas human
B2GP11-C Human beta-2 glycoprotein (B2-GP or Apolipoprotein H/ApoH) W. Blot +ve control 100 μL 333 € adi human
B2GP11-M monoclonal Anti-Human beta-2 glycoprotein (B2-GP or Apolipoprotein H/ApoH) 100 μg 565 € adi human
B2GP13-M Monoclonal Anti-Human beta-2 glycoprotein (B2-GP or Apolipoprotein H/ApoH) 100 μg 565 € adi human
B2GP12-M Monoclonal Anti-Human beta-2 glycoprotein (B2-GP or Apolipoprotein H/ApoH) ascites 100 μL 565 € adi human
B2GP15-N-25 Purified human plasma beta-2 glycoprotein (B2-GP or Apolipoprotein H/ApoH) protein for ELISA 25 μg 289 € adi human
GENTAUR-58bdc67bcf583 Anti- Apolipoprotein H (APOH) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdc70eb7556 Anti- Apolipoprotein H (APOH) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdc957ddfc8 Anti- Apolipoprotein H (APOH) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdc95849c08 Anti- Apolipoprotein H (APOH) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdc9ba549e5 Anti- Apolipoprotein H (APOH) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc9baaa5ad Anti- Apolipoprotein H (APOH) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcf943125e Anti- Apolipoprotein H (APOH) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdcf94a5e70 Anti- Apolipoprotein H (APOH) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd08c5cac2 Anti- Apolipoprotein H (APOH) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd434ac5a8 Anti- Apolipoprotein H (APOH) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd89549a71 Anti- Apolipoprotein H (APOH) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddd2b9289b Anti- Apolipoprotein H (APOH) Antibody 100ug 597 € MBS Polyclonals human
abx575248 Anti-Cow Apolipoprotein H (APOH) ELISA Kit inquire 50 € abbex cow
abx575249 Anti-Dog Apolipoprotein H (APOH) ELISA Kit inquire 50 € abbex dog
abx575331 Anti-Mouse Apolipoprotein H (APOH) ELISA Kit inquire 50 € abbex mouse
abx573757 Anti-Rat Apolipoprotein H (APOH) ELISA Kit 96 tests 775 € abbex rat
EKU02524 Apolipoprotein H (APOH) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU02525 Apolipoprotein H (APOH) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human