Recombinant Human TWSG1, TSG (C-6His)

Contact us
Catalog number: C392
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Human TWSG1, TSG (C-6His)
Quantity: 100ul
Other quantities: 1 mg 2283€ 10 µg 168€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human TWSG1 is produced by our Mammalian expression system and the target gene encoding Cys26-Phe223 is expressed with a 6His tag at the C-terminus
Molecular Weight: 18 kD, 23
UniProt number: Q9GZX9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TSG (C-6His), TWSG1
Short name: TSG (C-6His), Recombinant TWSG1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TSG (C-6His), sapiens TWSG1, recombinant H
Alternative technique: rec
Identity: 12429
Gene: TWSG1 | More about : TWSG1
Long gene name: twisted gastrulation BMP signaling modulator 1
Synonyms gene name: twisted gastrulation homolog 1 (Drosophila)
Synonyms: TSG
Locus: 18p11, 22
Discovery year: 2000-02-16
GenBank acession: AA486291
Entrez gene record: 57045
Pubmed identfication: 11260715
Havana BLAST/BLAT: OTTHUMG00000131597

Related Products :

C392 Recombinant Human TWSG1, TSG (C-6His) 1 mg 2283 € novo human
GENTAUR-58bde8704c230 Mouse Monoclonal [clone 2F3] (IgG2a,k) to Human TSG / TWSG1 Antibody 50ug 663 € MBS mono human
AR01019PU-N anti-TWSG1 / Tsg Antibody 50 Вµg 384 € acr human
AR01019PU-S anti-TWSG1 / Tsg Antibody 10 Вµg 253 € acr human
DM3604P anti-TWSG1 / Tsg Antibody 0,1 mg 688 € acr human
RP-1285H Recombinant Human PTX3 / Pentraxin 3 / TSG-14 Protein (His Tag) 20μg 572 € adv human
GWB-BIG13B Recombinant Human TSG bulk Ask price € genways bulk human
PTX36-R-25 Recombinant Purified, Human PTX3 (TSG-14) protein 25 μg 913 € adi human
PTX36-R-5 Recombinant Purified, Human PTX3 (TSG-14) protein 5 μg 333 € adi human
PTX35-R-25 Recombinant Purified, Mouse PTX3 (TSG-14) protein 25 μg 913 € adi mouse
PTX35-R-5 Recombinant Purified, Mouse PTX3 (TSG-14) protein 5 μg 333 € adi mouse
ZR-40-205 TSG Recombinant Protein 0.01 mg 256 € Zyagen human
RP-1580M Recombinant Mouse TWSG1 Protein (His Tag) 50μg 624 € adv mouse
PTX33-A Goat Anti-Human Pentraxin 3 (PTX3/TSG-14) protein IgG, aff pure 100 μg 565 € adi human
PTX33-C Human Pentraxin 3 (PTX3/TSG-14) protein control for WB 100 μL 333 € adi human
103-M281 Anti-Mouse TSG (Twisted gastrulation) 100ug 336 € Reliatech antibodies mouse
PTX32-M Monoclonal Anti-Mouse Pentraxin 3 (PTX3/TSG-14) 100 μg 565 € adi mouse
PTX31-P Mouse Pentraxin 3 (PTX3/TSG-14) Control/blocking peptide #1 100 μg 188 € adi mouse
PTX32-C Mouse Pentraxin 3 (PTX3/TSG-14) protein control for WB 100 μL 333 € adi mouse
PTX31-A Rabbit Anti-Mouse Pentraxin 3 (PTX3/TSG-14) IgG #1, aff pure 100 μg 565 € adi mouse
GWB-E5E69F Tumor necrosis factor-inducible protein TSG-6 bulk Ask price € genways bulk human
abx153413 Anti-Human TWSG1 ELISA Kit inquire 50 € abbex human
abx572547 Anti-Human TWSG1 ELISA Kit inquire 50 € abbex human
DL-TWSG1-Hu Human Twisted Gastrulation Protein Homolog 1 TWSG1 ELISA Kit 96T 904 € DL elisas human
LV349283 TWSG1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be5b6f8484b Anti-TWSG1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx938631 Anti-TWSG1 siRNA 30 nmol 717 € abbex human
abx938632 Anti-TWSG1 siRNA inquire 50 € abbex human
EKU07995 Twisted Gastrulation Protein Homolog 1 (TWSG1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
bs-11606R-A350 TWSG1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human