Recombinant Human Tissue Factor Pathway Inhibitor 2, TFPI-2, PP5, REF-1 (C-6His)

Contact us
Catalog number: C390
Price: 568 €
Supplier: elabsciences
Product name: Recombinant Human Tissue Factor Pathway Inhibitor 2, TFPI-2, PP5, REF-1 (C-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins 
Molecular Weight: 22, 88 kD
UniProt number: P48307
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PP5, REF-1 (C-6His), TFPI-2, Tissue Factor Pathway Inhibitor 2
Short name: PP5, REF-1 (C-6His), TFPI-2, Recombinant Tissue Factor Pathway Inhibitor 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PP5, REF-1 (C-6His), TFPI-2, sapiens Tissue Factor Pathway suppressor 2, recombinant H
Alternative technique: rec
Identity: 11761
Gene: TFPI2 | More about : TFPI2
Long gene name: tissue factor pathway inhibitor 2
Synonyms: PP5 TFPI-2 REF1
Locus: 7q21, 3
Discovery year: 1999-07-14
GenBank acession: L27624
Entrez gene record: 7980
Pubmed identfication: 7896752 8945635
RefSeq identity: NM_006528
Havana BLAST/BLAT: OTTHUMG00000022963

Related Products :

C390 Recombinant Human Tissue Factor Pathway Inhibitor 2, TFPI-2, PP5, REF-1 (C-6His) 10 µg 202 € novo human
AE17135HU-48 ELISA test for Human Tissue factor pathway inhibitor (TFPI) 1x plate of 48 wells 402 € abebio human
AE17135HU Human Tissue factor pathway inhibitor (TFPI) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE17135HU-96 Human Tissue factor pathway inhibitor (TFPI) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-TFPI-Hu Human Tissue Factor Pathway Inhibitor TFPI ELISA Kit 96T 672 € DL elisas human
MBS512162 Sheep anti-human Tissue Factor Pathway Inhibitor (TFPI), Purified IgG 10 miligrams 442 € MBS Polyclonals_1 sheep
GENTAUR-58bdc33a93650 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc33aeeaba Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc52ad70c4 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcd7436784 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcd7498754 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdcdbb084b8 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdcdbb6fbb3 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcdef8d47d Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 448 € MBS Polyclonals human
GENTAUR-58bdcdf05b876 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 50ug 348 € MBS Polyclonals human
GENTAUR-58bdced09a119 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdced10742d Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcfcc7eb7d Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd104e1e8d Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 376 € MBS Polyclonals human
GENTAUR-58bdd11d9545f Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdd11e076ff Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd2ebe058a Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd3596ae77 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd3c1a20be Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd6cceb1f8 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd72bc5fc3 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd803c4d4a Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddac0575a3 Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddbeb53c6b Anti- Tissue Factor Pathway Inhibitor (TFPI) Antibody 100ug 531 € MBS Polyclonals human
E-EL-Ch0139 Chicken TFPI (Tissue Factor Pathway Inhibitor) ELISA Kit 96T 568 € elabsciences chicken