Recombinant Human Biglycan, BGN (C-6His)

Contact us
Catalog number: C386
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Biglycan, BGN (C-6His)
Quantity: inquire
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Biglycan is produced by our Mammalian expression system and the target gene encoding Glu20-Lys368 is expressed with a 6His tag at the C-terminus
Molecular Weight: 40, 47 kD
UniProt number: P21810
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BGN (C-6His), Biglycan
Short name: BGN (C-6His), Recombinant Biglycan
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BGN (C-6His), sapiens Biglycan, recombinant H
Alternative technique: rec
Identity: 1044
Gene: BGN | More about : BGN
Long gene name: biglycan
Synonyms: DSPG1 SLRR1A
Synonyms name: biglycan proteoglycan
Locus: Xq28
Discovery year: 1989-07-18
GenBank acession: AK092954
Entrez gene record: 633
Pubmed identfication: 1612609
RefSeq identity: NM_001711
Classification: Small leucine rich repeat proteoglycans
Havana BLAST/BLAT: OTTHUMG00000024205
Locus Specific Databases: Mental Retardation database

Related Products :

C386 Recombinant Human Biglycan, BGN (C-6His) 1 mg 2283 € novo human
RP-0130H Recombinant Human Biglycan / BGN Protein (His Tag) 50μg 624 € adv human
RP-1052M Recombinant Mouse Biglycan / PG-S1 / BGN Protein (Fc Tag) 50μg 624 € adv mouse
abx572494 Anti-Human Biglycan (BGN) ELISA Kit inquire 50 € abbex human
DL-BGN-Hu Human Biglycan BGN ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc1bf7ef6a Anti- Biglycan (BGN) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc4602c848 Anti- Biglycan (BGN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc4d718e40 Anti- Biglycan (BGN) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc710ab742 Anti- Biglycan (BGN) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc7113b58f Anti- Biglycan (BGN) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc8c12ca8d Anti- Biglycan (BGN) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc8c1a2451 Anti- Biglycan (BGN) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdca7e9d58e Anti- Biglycan (BGN) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdca7eef6ef Anti- Biglycan (BGN) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdca94a4158 Anti- Biglycan (BGN) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdca9512371 Anti- Biglycan (BGN) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcb2da5595 Anti- Biglycan (BGN) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcb2e1d59d Anti- Biglycan (BGN) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd0ab7df5c Anti- Biglycan (BGN) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd0abdc4ec Anti- Biglycan (BGN) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd1a3597d8 Anti- Biglycan (BGN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd2b72333d Anti- Biglycan (BGN) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd371c6525 Anti- Biglycan (BGN) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd4ee8f474 Anti- Biglycan (BGN) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd6d659ab4 Anti- Biglycan (BGN) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd8e47848a Anti- Biglycan (BGN) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd9b3d8411 Anti- Biglycan (BGN) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddb0c7c9b6 Anti- Biglycan (BGN) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddd6dccf62 Anti- Biglycan (BGN) Antibody 100ug 564 € MBS Polyclonals human
abx575300 Anti-Mouse Biglycan (BGN) ELISA Kit inquire 50 € abbex mouse