Recombinant Human Polymeric Immunoglobulin Receptor, PIgR (C-6His)

Contact us
Catalog number: C381
Price: 586 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Polymeric Immunoglobulin Receptor, PIgR (C-6His)
Quantity: 100ug
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Poly-Ig receptor is produced by our Mammalian expression system and the target gene encoding Lys19-Arg638 is expressed with a 6His tag at the C-terminus
Molecular Weight: 68, 88 kD
UniProt number: P01833
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PIgR (C-6His), Polymeric Immunoglobulin Receptor
Short name: PIgR (C-6His), Recombinant Polymeric Immunoglobulin Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: polymeric immunoglobulin receptor (C-6His), sapiens Polymeric Immunoglobulin Receptor, recombinant H
Alternative technique: rec

Related Products :

C381 Recombinant Human Polymeric Immunoglobulin Receptor, PIgR (C-6His) 50 µg 273 € novo human
CI09 Recombinant Human Polymeric Immunoglobulin Receptor, PIgR (C-Fc) 1 mg 2283 € novo human
DL-PIGR-Hu Human Polymeric Immunoglobulin Receptor PIGR ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdc212ea2ef Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc21366298 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc23bb1074 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc23c27fc9 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdc2983067e Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdc29bd4dcb Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc29c3c733 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdc2c6665a9 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc47b8ba53 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc5efce8d7 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc5f01f9c4 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc7769b69e Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc776ecd3d Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc8e1b0573 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc8e22eef3 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdca5a98a37 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdca5aee087 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcb61bd746 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcb6292000 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdcc40f11a3 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcc4168411 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdcdc8d3557 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcdc943d98 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcdc9afa9d Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 586 € MBS Polyclonals human
GENTAUR-58bdd17c11d8d Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd21eaeaba Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd2a930d73 Anti- Polymeric Immunoglobulin Receptor (PIGR) Antibody 100ug 586 € MBS Polyclonals human