Recombinant Human Matrix Metalloproteinase-2, MMP-2 (C-6His)

Contact us
Catalog number: C377
Price: 1125 €
Supplier: accurate-monoclonals
Product name: Recombinant Human Matrix Metalloproteinase-2, MMP-2 (C-6His)
Quantity: 1000ul
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Matrix Metalloproteinase-2 is produced by our Mammalian expression system and the target gene encoding Ala30-Cys660 is expressed with a 6His tag at the C-terminus
Molecular Weight: 01 kD, 72
UniProt number: P08253
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MMP-2 (C-6His), Matrix Metalloproteinase-2
Short name: MMP-2 (C-6His), Recombinant Matrix Metalloproteinase-2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MMP-2 (C-6His), sapiens Matrix Metalloproteinase-2, recombinant H
Alternative technique: rec

Related Products :

MBS623391 MMP15, NT (Matrix Metalloproteinase-15, MMP-15, Membrane-type Matrix Metalloproteinase 2, MT-MMP 2, MTMMP2, Membrane-type-2 Matrix Metalloproteinase, MT2-MMP, MT2MMP, SMCP-2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624252 MMP24, ID (Matrix Metalloproteinase-24, MMP-24, Membrane-type Matrix Metalloproteinase 5, MT-MMP 5, MTMMP5, Membrane-type-5 Matrix Metalloproteinase, MT5-MMP, MT5MMP, MT5MMP) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621864 Matrix Metalloproteinase 15, Prodomain (Matrix Metallopeptidase 15 (Membrane-inserted), MMP-15, MMP15, Membrane-type Matrix Metalloproteinase 2, MT-MMP 2, MTMMP2, Membrane-type-2 Matrix Metalloproteinase, MT2-MMP, MT2MMP, SMCP-2) Antibody 100ug 641 € MBS Polyclonals_1 human
MBS618062 Matrix Metalloproteinase 16, Hinge Region (MT3-MMP, MMP-16, Membrane-type Matrix Metalloproteinase-3) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS623255 MMP-2, hinge region (matrix metallopeptidase 2, 72kD Gelatinase, 72kD Type IV Collagenase, CLG4, CLG4A, Gelatinase A, Matrix Metalloproteinase-2, MMP-II, MONA, TBE-1) Antibody 100ug 674 € MBS Polyclonals_1 human
MBS616724 Matrilysin (MMP7, matrix metalloproteinase 7 (matrilysin, uterine), HGNC:7174, MMP-7, MPSL1, PUMP-1, matrin, matrix metalloproteinase 7, uterine matrilysin) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS621381 Matrix Metalloproteinase 16, Prodomain (Matrix Metallopeptidase 16 (Membrane-inserted), MMP-16, MMP16, C8orf57, DKFZp761D112, Membrane-type Matrix Metalloproteinase 3, MT-MMP 3, MTMMP3, Membrane-type-3 Matrix Metalloproteinase, MT3-MMP, MT3MMP, MMP-X2, MM Antibody 100ug 641 € MBS Polyclonals_1 human
C374 Recombinant Human Matrix Metalloproteinase-1, MMP-1 (C-6His) 500 µg 1613 € novo human
C377 Recombinant Human Matrix Metalloproteinase-2, MMP-2 (C-6His) 500 µg 1613 € novo human
C378 Recombinant Human Matrix Metalloproteinase-3, MMP-3 (C-6His) 1 mg 2283 € novo human
CI71 Recombinant Human Matrix Metalloproteinase-9, MMP-9 (C-6His) 50 µg 496 € novo human
MBS623753 Matrix Metalloproteinase 7, ID (MMP-7, Matrilysin, Matrin, Pump1, Uterine Metalloproteinase, MPSL1) Antibody 200ul 603 € MBS Polyclonals_1 human
abx572303 Anti-Rat Matrix Metalloproteinase 11 (Matrix Metalloproteinase 11 (MMP11)) ELISA Kit inquire 50 € abbex rat
MBS621006 West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) 100ug 658 € MBS Polyclonals_1 virus
MBS620959 West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) Antibody 100ug 857 € MBS Polyclonals_1 virus
GWB-4E6B35 Matrix Metalloproteinase-9 ( MMP-9) recombinant 1 x 1 vial 971 € genways human
CC25 Recombinant Mouse Matrix Metalloproteinase-9, MMP-9 1 mg 2486 € novo mouse
AE33305HU-48 ELISA test for Human Matrix Metalloproteinase 12 (MMP-12) 1x plate of 48 wells 402 € abebio human
AE63045HU-48 ELISA test for Human Matrix metalloproteinase 13 (MMP-13) 1x plate of 48 wells 360 € abebio human
AE33295HU-48 ELISA test for Human Matrix Metalloproteinase 14 (MMP-14) 1x plate of 48 wells 402 € abebio human
AE33305HU Human Matrix Metalloproteinase 12 (MMP-12) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE33305HU-96 Human Matrix Metalloproteinase 12 (MMP-12) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE63045HU Human Matrix metalloproteinase 13 (MMP-13) ELISA Kit 48 wells plate 465 € ab-elisa elisas human
AE63045HU-96 Human Matrix metalloproteinase 13 (MMP-13) ELISA Kit 1x plate of 96 wells 587 € abebio human
AE33295HU Human Matrix Metalloproteinase 14 (MMP-14) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE33295HU-96 Human Matrix Metalloproteinase 14 (MMP-14) ELISA Kit 1x plate of 96 wells 671 € abebio human
KT-1867 Human Matrix Metalloproteinase 9 (MMP-9) ELISA kit 96 well plate 505 € Kamiya human
MEDRPR011 MMP-19 (Matrix Metalloproteinase 19), Clone: 9F6, Mouse Monoclonal antibody-Human; paraffin, IHC 1000ul 1246 € accurate-monoclonals human
MEDRPR010-01 MMP-2 (Matrix Metalloproteinase 2), Clone: 17B11, Mouse Monoclonal antibody-Human; paraffin, IHC 0.1000ul 428 € accurate-monoclonals human
MEDRPR010-1 MMP-2 (Matrix Metalloproteinase 2), Clone: 17B11, Mouse Monoclonal antibody-Human; paraffin, IHC 1000ul 1125 € accurate-monoclonals human