Recombinant Human Lumican, LUM (C-6His)

Contact us
Catalog number: C372
Price: 1923 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Lumican, LUM (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Lumican is produced by our Mammalian expression system and the target gene encoding Gln19-Asn338 is expressed with a 6His tag at the C-terminus
Molecular Weight: 37, 7 kD
UniProt number: P51884
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM EDTA, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LUM (C-6His), Lumican
Short name: LUM (C-6His), Recombinant Lumican
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: LUM (C-6His), sapiens Lumican, recombinant H
Alternative technique: rec
Identity: 6724
Gene: LUM | More about : LUM
Long gene name: lumican
Synonyms gene: LDC
Synonyms: SLRR2D
Synonyms name: lumican proteoglycan
Locus: 12q21, 33
Discovery year: 1994-12-19
GenBank acession: BT006707
Entrez gene record: 4060
Pubmed identfication: 7558030
RefSeq identity: NM_002345
Classification: Small leucine rich repeat proteoglycans
Havana BLAST/BLAT: OTTHUMG00000170074

Related Products :

C372 Recombinant Human Lumican, LUM (C-6His) 1 mg 2283 € novo human
RP-1027H Recombinant Human Lumican / LUM Protein (His Tag) 50μg 624 € adv human
AE58381HU-48 ELISA test for Human Lumican (LUM) 1x plate of 48 wells 402 € abebio human
AE58381HU Human Lumican (LUM) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE58381HU-96 Human Lumican (LUM) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-LUM-Hu Human Lumican LUM ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdc56fa46e9 Anti- Lumican (LUM) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc88f296d9 Anti- Lumican (LUM) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc88f91e4d Anti- Lumican (LUM) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcccb85393 Anti- Lumican (LUM) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdcd78e4880 Anti- Lumican (LUM) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdcd794d3da Anti- Lumican (LUM) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd8ec145da Anti- Lumican (LUM) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddb6712a24 Anti- Lumican (LUM) Antibody 100ug 542 € MBS Polyclonals human
E-EL-Ch0211 Chicken LUM (Lumican) ELISA Kit 96T 568 € elabsciences chicken
GENTAUR-58bd61662e322 Coturnix coturnix japonica Lumican (LUM) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bd61667737a Coturnix coturnix japonica Lumican (LUM) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bd6166b4fea Coturnix coturnix japonica Lumican (LUM) 100ug 2448 € MBS Recombinant Proteins human
GENTAUR-58bd616708d7c Coturnix coturnix japonica Lumican (LUM) 1000ug 2448 € MBS Recombinant Proteins human
AE34817RB-48 ELISA test for Rabbit Lumican (LUM) 1x plate of 48 wells 402 € abebio human
R32130 Lumican Antibody / LUM 0.1mg 406 € NJS poly human
EKU05689 Lumican (LUM) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
GENTAUR-58be23b469e10 Monocloncal Antibody to Lumican (Clone Lum-1) 100ug 498 € MBS mono human
GENTAUR-58bb55be361a6 Rabbit Lumican (LUM) 100ug 1591 € MBS Recombinant Proteins human
GENTAUR-58bb55be8b74c Rabbit Lumican (LUM) 1000ug 1591 € MBS Recombinant Proteins human
GENTAUR-58bb55bec903d Rabbit Lumican (LUM) 100ug 2105 € MBS Recombinant Proteins human
GENTAUR-58bb55bf23843 Rabbit Lumican (LUM) 1000ug 2105 € MBS Recombinant Proteins human
AE34817RB Rabbit Lumican (LUM) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE34817RB-96 Rabbit Lumican (LUM) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58b89a462719d Rat Lumican (Lum) 100ug 1923 € MBS Recombinant Proteins rat