Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ala18-Pro261, C-6His)

Contact us
Catalog number: C365
Price: 769 €
Supplier: ab-elisa elisas
Product name: Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ala18-Pro261, C-6His)
Quantity: 96 wells plate
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Kallikrein 3 is produced by our Mammalian expression system and the target gene encoding Ala18-Pro261 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27, 88 kD
UniProt number: P07288
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 mM CaCl2, pH 6, 2 um filtered solution of 20 mM MES, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C-6His), KLK3 (Ala18-Pro261, PSA, Prostate-Specific
Short name: C-6His), KLK3 (Ala18-Pro261, PSA, Recombinant Prostate-Specific Antigen
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: , C-6His), KLK3 (Ala18-Pro261, PSA, sapiens Prostate-Specific protein, recombinant H
Alternative technique: rec
Identity: 6371
Gene: KLKB1 | More about : KLKB1
Long gene name: kallikrein B1
Synonyms gene: KLK3
Synonyms gene name: kallikrein B, plasma (Fletcher factor) 1
Synonyms name: Fletcher factor
Locus: 4q35, 2
Discovery year: 1999-04-23
GenBank acession: M13143
Entrez gene record: 3818
Pubmed identfication: 9535413 3521732
RefSeq identity: NM_000892
Classification: Kallikreins
Havana BLAST/BLAT: OTTHUMG00000150347

Related Products :

C365 Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ala18-Pro261, C-6His) 10 µg 202 € novo human
CI30 Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ile25-Pro261, C-6His) 500 µg 1613 € novo human
PSA20-R-10 Recombinant (HEK) Human Prostate Specific Antigen (PSA/KLKB1/Kallikrein-3/KLK3) protein (His-tag, >95%, low endotoxin, active) 10 μg 333 € adi human
PSA20-R-50 Recombinant (HEK) Human Prostate Specific Antigen (PSA/KLKB1/Kallikrein-3/KLK3) protein (His-tag, >95%, low endotoxin, active) 50 μg 1058 € adi human
MBS610873 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1 mililiter 470 € MBS Polyclonals_1 human
MBS612293 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1000ug 641 € MBS Polyclonals_1 human
MBS618778 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) Antibody 1 mililiter 470 € MBS Polyclonals_1 human
E-EL-Ch0336 Chicken PSA/KLK3 (Prostate Specific Antigen) ELISA Kit 96T 568 € elabsciences chicken
MEDCLA647 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human 7 ml 556 € accurate-monoclonals human
MEDCLA155 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 1000ul 855 € accurate-monoclonals human
MEDCLA644 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 7 ml Ask price € accurate-monoclonals human
MEDCLA645 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 12 ml 374 € accurate-monoclonals human
MEDCLA739 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/No WB 1000ul 855 € accurate-monoclonals human
GWB-8446B5 Kallikrein 3 Prostate specificity Antigen (KLK3/PSA) Mouse antibody to or anti-Human Monoclonal (ER-PR8) antibody 1 vial 602 € genways human
GWB-60CAD0 Kallikrein 3, Prostate specificity Antigen (KLK3/PSA) Rabbit antibody to or anti-Human Polyclonal antibody 1 tube 648 € genways human
BA1022 anti-Kallikrein-3 / PSA / KLK3 (PSA-ACT Complex) Antibody 50 Вµg 1471 € acr human
BM213-Z8B5 anti-Kallikrein-3 / PSA / KLK3 Free Prostate Antibody 0,1 mg 471 € acr human
BM214-D3C5 anti-Kallikrein-3 / PSA / KLK3 Total Prostate Antibody 0,1 mg 471 € acr human
BM214-G1E3 anti-Kallikrein-3 / PSA / KLK3 Total Prostate Antibody 0,1 mg 471 € acr human
BM214-G3D6 anti-Kallikrein-3 / PSA / KLK3 Total Prostate Antibody 0,1 mg 471 € acr human
Z7020091 Prostate Tumor Tissue Array - 17 cases of prostate tumors and 7 cases of normal and reactive prostate tissues. 5 slides 972 € BioChain human
GENTAUR-58be23dd0075e anti-human Prostate-Specific Antigen (PSA) monoclonal antibody 100ug 547 € MBS mono human
MBS301531 Anti-Human Prostate Specific Antigen (PSA) PAb 7 ml (RTU) 254 € MBS Polyclonals_1 human
MBS301532 Anti-Human Prostate Specific Antigen (PSA) PAb 100ul 188 € MBS Polyclonals_1 human
MBS301533 Anti-Human Prostate Specific Antigen (PSA) PAb 1 mililiter 332 € MBS Polyclonals_1 human
MBS302297 Anti-Human Prostate Specific Antigen (PSA) PAb 500ul 265 € MBS Polyclonals_1 human
AE36483HU-48 ELISA test for Human Prostate specific antigen (PSA) 1x plate of 48 wells 373 € abebio human
PSA17-A Goat Anti-human prostate specific antigen (PSA) IgG aff pure 1 mg 840 € adi human
PSA16-N-10 Human Prostate Specific Antigen (PSA)/ACT complex protein >99% pure 10 μg 1130 € adi human
AE36483HU Human Prostate specific antigen (PSA) ELISA Kit 96 wells plate 769 € ab-elisa elisas human