Recombinant Human Coxsackievirus and Adenovirus Receptor, CAR, CXADR (C-6His)

Contact us
Catalog number: C332
Price: 462 €
Supplier: Natrols and viral diagnostic antigens
Product name: Recombinant Human Coxsackievirus and Adenovirus Receptor, CAR, CXADR (C-6His)
Quantity: 1 mL
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Coxsackievirus and Adenovirus Receptor is produced by our Mammalian expression system and the target gene encoding Leu20-Gly237 is expressed with a 6His tag at the C-terminus
Molecular Weight: 08 kD, 25
UniProt number: P78310
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CAR, CXADR (C-6His), Coxsackievirus Adenovirus Receptor
Short name: CAR, CXADR (C-6His), Recombinant Coxsackievirus Adenovirus Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CAR, coxsackie virus and adenovirus receptor (C-6His), sapiens Coxsackievirus and Adenovirus Receptor, recombinant H
Alternative technique: rec
Alternative to gene target: CAR and CAR4/6 and HCAR, CXADR and IDBG-630474 and ENSBTAG00000004869 and 281733, CXADR and IDBG-854 and ENSG00000154639 and 1525, Gm1123 and IDBG-192613 and ENSMUSG00000044860 and 382097, connexin binding, nuclei, this GO :0001618 and virus receptor activity and molecular function this GO :0001669 and acrosomal vesicle and cellular component this GO :0005102 and receptor binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0005912 and adherens junction and cellular component this GO :0005923 and tight junction and cellular component this GO :0007005 and mitochondrion organization and biological process this GO :0007157 and heterophilic cell-cell adhesion and biological process this GO :0007507 and heart development and biological process this GO :0007596 and blood coagulation and biological process this GO :0008013 and beta-catenin binding and molecular function this GO :0008354 and germ cell migration and biological process this GO :0009615 and response to virus and biological process this GO :0010669 and epithelial structure maintenance and biological process this GO :0014704 and intercalated disc and cellular component this GO :0016032 and viral process and biological process this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016327 and apicolateral plasma membrane and cellular component this GO :0030054 and cell junction and cellular component this GO :0030165 and PDZ domain binding and molecular function this GO :0030175 and filopodium and cellular component this GO :0030426 and growth cone and cellular component this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0031594 and neuromuscular junction and cellular component this GO :0034109 and homotypic cell-cell adhesion and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043005 and neuron projection and cellular component this GO :0043234 and protein complex and cellular component this GO :0044297 and cell body and cellular component this GO :0045121 and membrane raft and cellular component this GO :0045216 and cell-cell junction organization and biological process this GO :0046629 and gamma-delta T cell activation and biological process this GO :0048739 and cardiac muscle fiber development and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0050900 and leukocyte migration and biological process this GO :0051607 and defense response to virus and biological process this GO :0070633 and transepithelial transport and biological process this GO :0071253 and connexin binding and molecular function this GO :0086067 and AV node cell to bundle of His cell communication and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005102 : receptor binding and also this GO :0005178 : integrin binding and also this GO :0005515 : protein binding and also this GO :0008013 : beta-catenin binding and also this GO :0030165 : PDZ domain binding and also this GO :0042802 : identical protein binding and also this GO :0050839 : cell adhesion molecule binding and also this GO :0071253 : connexin binding, this GO :0005102 : receptor binding, this GO :0005178 : integrin binding, this GO :0005515 : protein binding, this GO :0008013 : beta-catenin binding, this GO :0030165 : PDZ domain binding, this GO :0042802 : identical protein binding, this GO :0050839 : cell adhesion molecule binding, this GO :0071253 : connexin binding, coxsackie virus and adenovirus receptor
Identity: 2559
Gene: CXADR | More about : CXADR
Long gene name: coxsackie virus and adenovirus receptor
Synonyms: CAR
Locus: 21q21, 1
Discovery year: 1998-03-24
GenBank acession: Y07593
Entrez gene record: 1525
Pubmed identfication: 9036860 9096397
Classification: Immunoglobulin like domain containing V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000074508

Related Products :

C332 Recombinant Human Coxsackievirus and Adenovirus Receptor, CAR, CXADR (C-6His) 50 µg 273 € novo human
AE48317BO Bovine Coxsackievirus and adenovirus receptor (CXADR) ELISA Kit 48 wells plate 500 € ab-elisa elisas bovine
AE48317BO-96 Bovine Coxsackievirus and adenovirus receptor (CXADR) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE48317BO-48 ELISA test for Bovine Coxsackievirus and adenovirus receptor (CXADR) 1x plate of 48 wells 402 € abebio bovine
AE48315MO-48 ELISA test for Mouse Coxsackievirus and adenovirus receptor (CXADR) 1x plate of 48 wells 373 € abebio mouse
AE48315MO Mouse Coxsackievirus and adenovirus receptor (CXADR) ELISA Kit 48 wells plate 480 € ab-elisa elisas mouse
AE48315MO-96 Mouse Coxsackievirus and adenovirus receptor (CXADR) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
MBS619124 Constitutive Androstane Receptor (CAR, CAR BETA CAR1, CARA, Constitutive activator of retinoid response, Constitutive active response, MGC97144, Nuclear receptor subfamily 1 group I member 3, Orphan nuclear receptor MB67, Orphan nuclear receptor NR1I3) Antibody 100ug 735 € MBS Polyclonals_1 human
RP-0515H Recombinant Human CXADR / CAR Protein (His & Fc Tag) 50μg 624 € adv human
RP-1226M Recombinant Mouse CXADR / CAR Protein 20μg 572 € adv mouse
RP-1227M Recombinant Mouse CXADR / CAR Protein (ECD, Fc & His Tag) 50μg 624 € adv mouse
DL-CXADR-Hu Human Coxsackie Virus And Adenovirus Receptor CXADR ELISA Kit 96T 904 € DL elisas virus
EKU03482 Coxsackie Virus And Adenovirus Receptor (CXADR) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits virus
abx250834 Anti-Human Coxsackievirus and adenovirus receptor ELISA Kit inquire 50 € abbex human
R30950 CAR Antibody Coxsackie Adenovirus Receptor 0.1mg 389 € NJS poly human
GENTAUR-58bb8d171b14d Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58bb8d17592ba Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58bb8d17a9581 Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bb8d17f111e Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B 1000ug 2022 € MBS Recombinant Proteins human
GWB-ATG329 CXADR, 20-237aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
0835140CF Coxsackievirus Type A1 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835106CF Coxsackievirus Type A10 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835144CF Coxsackievirus Type A15 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835107CF Coxsackievirus Type A16 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835141CF Coxsackievirus Type A2 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835235CF Coxsackievirus Type A21 2005 Isolate control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835018CF Coxsackievirus Type A21 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835142CF Coxsackievirus Type A4 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human
0835143CF Coxsackievirus Type A8 control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens human