Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-6His)

Contact us
Catalog number: C322
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-6His)
Quantity: inquire
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 50, 54 kD
UniProt number: P05362
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD54 (C-6His), ICAM-1, Intercellular Adhesion Molecule 1
Short name: CD54 (C-6His), ICAM-1, Recombinant Intercellular Adhesion Molecule 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD54 (C-6His), ICAM-1, sapiens Intercellular Adhesion Molecule 1, recombinant H
Alternative technique: rec
Identity: 5344
Gene: ICAM1 | More about : ICAM1
Long gene name: intercellular adhesion molecule 1
Synonyms: BB2 CD54
Synonyms name: human rhinovirus receptor
Locus: 19p13, 2
Discovery year: 1989-04-24
Entrez gene record: 3383
Pubmed identfication: 2453850 3871395
Classification: Endogenous ligands CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000180403

Related Products :

C322 Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-6His) 500 µg 1613 € novo human
CD35 Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-Fc) 1 mg 2283 € novo human
AE38996RB-48 ELISA test for Rabbit Intercellular adhesion molecule 1 (ICAM-1/CD54) 1x plate of 48 wells 360 € abebio human
AE38996RB Rabbit Intercellular adhesion molecule 1 (ICAM-1/CD54) ELISA Kit 48 wells plate 465 € ab-elisa elisas human
AE38996RB-96 Rabbit Intercellular adhesion molecule 1 (ICAM-1/CD54) ELISA Kit 1x plate of 96 wells 587 € abebio human
C306 Recombinant Human Intercellular Adhesion Molecule 2, ICAM-2, CD102 (C-6His) 1 mg 2283 € novo human
CK81 Recombinant Mouse Intercellular Adhesion Molecule 2, ICAM-2, CD102 (C-Fc) 500 µg 659 € novo mouse
AE38993PI-48 ELISA test for Pig intercellular adhesion molecule 2 (ICAM-2) 1x plate of 48 wells 360 € abebio pig
AE38988PI-48 ELISA test for Pig intercellular adhesion molecule 3 (ICAM-3) 1x plate of 48 wells 360 € abebio pig
AE38993PI-96 Pig intercellular adhesion molecule 2 (ICAM-2) ELISA Kit 1x plate of 96 wells 587 € abebio pig
AE38988PI-96 Pig intercellular adhesion molecule 3 (ICAM-3) ELISA Kit 1x plate of 96 wells 587 € abebio pig
GWB-D3A38A CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1), antibody 1 vial 486 € genways human
GWB-F153BC CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1), antibody 1 vial 568 € genways human
RP-837 Recombinant (E.Coli, His-tag) Human Intercellular Adhesion Molecule-1 10 μg 333 € adi human
abx260651 Anti-Intercellular Adhesion Molecule-1, HEK Protein (Recombinant) 1 mg 3385 € abbex human
abx166350 Anti-Intercellular Adhesion Molecule 1 Protein (Recombinant) 100 μg 934 € abbex human
abx167572 Anti-Intercellular Adhesion Molecule 1 Protein (Recombinant) 10 μg 398 € abbex human
abx262054 Anti-Intercellular Adhesion Molecule-1 Protein (Recombinant) 10 µg 340 € abbex human
abx167752 Anti-Intercellular Adhesion Molecule 2 Protein (Recombinant) 100 μg 920 € abbex human
abx262761 Anti-Intercellular Adhesion Molecule-2 Protein (Recombinant) 1 mg 6662 € abbex human
abx168342 Anti-Intercellular Adhesion Molecule 4 Protein (Recombinant) 100 μg 833 € abbex human
abx167266 Anti-Intercellular Adhesion Molecule 5 Protein (Recombinant) 10 μg 398 € abbex human
YSRTMCA1135 CD54, ICAM-1, Clone: 6.5B5, Mouse Monoclonal antibody-Human; frozen, IH/flow/ELISA/IP, Inhibits Adhesion 2 ml 489 € accurate-monoclonals human
YSRTMCA532F CD54, ICAM-1, Clone: 84H10, Mouse Monoclonal antibody-Human, FITC; flow/Inhibits adhesion vial 532 € accurate-monoclonals human
YSRTMCA1615F CD54, ICAM-1, Endothelial Cell, Clone: 15.2, Mouse Monoclonal antibody-Human, FITC; flow/Inhibits adhesion 0.1 mg 404 € accurate-monoclonals human
YSRTMCA1615 CD54, ICAM-1, Endothelial Cell, Clone: 15.2, Mouse Monoclonal antibody-Human; frozen, IH/flow/IP/Inhibits adhesion 200ug 462 € accurate-monoclonals human
YSRTMCA1615PE CD54, ICAM-1, Endothelial Cell, Clone: 15.2, Mouse Monoclonal antibody-Human, RPE; flow/Inhibits adhesion vial 432 € accurate-monoclonals human
YSRTMCA532 CD54, ICAM-1, subset veiled cells, Clone: 84H10, Mouse Monoclonal antibody-Human; frozen, IH/flow/IP/Inhibits adhesion 200ug 545 € accurate-monoclonals human
YSRTMCA532T CD54, ICAM-1, subset veiled cells, Clone: 84H10, Mouse Monoclonal antibody-Human; frozen, IH/flow/IP/Inhibits adhesion 25 ug 119 € accurate-monoclonals human
abx190120 Anti-Human Intercellular Adhesion Molecule 1 CLIA Kit inquire 50 € abbex human