| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
By understanding cell signaling, Cell nucleus signaling proteins and molecules are part of a complex system of communication that governs basic cellular activities and coordinates cell actions, Errors in cellular information processing are responsible for diseases such as cancer, The ability of cells to perceive and correctly respond to their microenvironment is the basis of development, and diabetes, and immunity as well as normal tissue homeostasis, artificial tissues may be created, autoimmunity, diseases may be treated effectively and, present in lysates used as reference for ELISA quantification of these molecules and their subunits, theoretically, tissue repair, Whole adhesion and interacting molecules are |
| Molecular Weight: |
25, 33 kD |
| UniProt number: |
Q13291 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD150 (C-6His), SLAM, Signaling Lymphocytic Activation Molecule |
| Short name: |
CD150 (C-6His), SLAM, Recombinant Signaling Lymphocytic Activation Molecule |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD150 (C-6His), SLAM, sapiens Signaling Lymphocytic Activation Molecule, recombinant H |
| Alternative technique: |
rec |
| Identity: |
10903 |
| Gene: |
SLAMF1 |
More about : SLAMF1 |
| Long gene name: |
signaling lymphocytic activation molecule family member 1 |
| Synonyms gene: |
SLAM |
| Synonyms gene name: |
signaling lymphocytic activation molecule |
| Synonyms: |
CD150 |
| Locus: |
1q23, 3 |
| Discovery year: |
1998-08-06 |
| GenBank acession: |
U33017 |
| Entrez gene record: |
6504 |
| Pubmed identfication: |
7617038 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000024006 |