Recombinant Human Heat Shock Factor Protein 2, HSF2 (N-6His)

Contact us
Catalog number: C284
Price: 709 €
Supplier: novo
Product name: Recombinant Human Heat Shock Factor Protein 2, HSF2 (N-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Heat Shock Factor Protein-2 is produced by our E, coli expression system and the target gene encoding Ser411-Ser536 is expressed with a 6His tag at the N-terminus
Molecular Weight: 15, 9 kD
UniProt number: Q03933
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HSF2 (N-6His), Heat Shock Factor Protein 2
Short name: HSF2 (N-6His), Recombinant Heat Shock Factor Protein 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: HSF2 (N-6His), sapiens Heat Shock Factor Protein 2, recombinant H
Alternative technique: rec
Identity: 5225
Gene: HSF2 | More about : HSF2
Long gene name: heat shock transcription factor 2
Locus: 6q22, 31
Discovery year: 1994-09-12
GenBank acession: M65217
Entrez gene record: 3298
Pubmed identfication: 1871106
RefSeq identity: NM_004506
Havana BLAST/BLAT: OTTHUMG00000016216

Related Products :

C284 Recombinant Human Heat Shock Factor Protein 2, HSF2 (N-6His) 10 µg 202 € novo human
MBS610061 Heat Shock Cognate Protein 71 (HSC71, Heat Shock Cognate 71kD Protein, Heat Shock 70kD Protein 8, HSPA8) 100ug 735 € MBS Polyclonals_1 human
YSGSPA960C Heat Shock Factor 2 (HSF2), ~69kD, Clone: 3E2, Rat Mouse Monoclonal antibody-Mouse, Human, Rat, Bovine, Dog, Guinea pig, Hamster, Monkey, Rabbit, Sheep; WB/IP 25 ug 536 € accurate-monoclonals sheep
BMDV10108 Heat Shock Factor 2 (HSF2), ~70kD, Clone: 3E2, Rat Mouse Monoclonal antibody-Human, Mouse, Monkey; IF/WB/IP (native only) 500ul 808 € accurate-monoclonals monkey
DL-HSF2-Hu Human Heat Shock Transcription Factor 2 HSF2 ELISA Kit 96T 846 € DL elisas human
AM12012PU-S anti-Heat shock factor 2 / HSF2 Antibody 25 Вµg 326 € acr human
AP06712PU-N anti-Heat shock factor 2 / HSF2 Antibody 0,1 mg 558 € acr human
BB-PA1607 anti-Heat shock factor 2 / HSF2 Antibody 0,1 mg 471 € acr human
C10871-1 anti-Heat shock factor 2 / HSF2 Antibody 50 Вµg 347 € acr human
C10871-2 anti-Heat shock factor 2 / HSF2 Antibody 0,1 mg 500 € acr human
GENTAUR-58bdd83d49b50 Anti- Heat Shock Transcription Factor 2 (HSF2) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd83da91bc Anti- Heat Shock Transcription Factor 2 (HSF2) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd9ed1a5e2 Anti- Heat Shock Transcription Factor 2 (HSF2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddb4938bdc Anti- Heat Shock Transcription Factor 2 (HSF2) Antibody 100ug 553 € MBS Polyclonals human
EKU04697 Heat Shock Transcription Factor 2 (HSF2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
RP-1638 Recombinant (E.Coli) Human Heat Shock Protein 90 B1 (HSP90b, Heat Shock Protein 90b, HSP90beta, HSP90β; >95%, 724-aa, ~83 kda, CT-His-tag) 10 μg 405 € adi human
MBS614716 Heat Shock Factor 2 Binding Protein (HSF2BP, Heat Shock Transcription Factor 2 Binding Protein) 50ug 625 € MBS Polyclonals_1 human
MBS620577 HSPE1 (Heat Shock 10kDa Protein 1, 10kD Heat Shock Protein Mitochondrial, Hsp10, 10kD Chaperonin, Chaperonin 10, CPN10, Early Pregnancy Factor, EPF, GROES) Antibody 100ug 553 € MBS Polyclonals_1 human
YSGSPA843C Heat Shock Protein 90 beta (Hsp90β), Heat Shock Protein 84 (Hsp84), NO X w/α (Hsp86), ~90kD, Clone: K3701, Mouse Monoclonal antibody-Human, Mouse, Rat, Bovine, Dog, Hamster, Guinea pig, Sheep, Rabbit; WB 25 ug 530 € accurate-monoclonals human
YSGSPA842C Heat Shock Protein 90 beta (Hsp90β), Heat Shock Protein 84 (Hsp84), NO X w/α (Hsp86), ~90kD, Clone: K3705, Mouse Monoclonal antibody-Human, Mouse, Rat, Bovine, Chicken, Dog, Hamster, Guinea pig, Sheep, Swine; WB 25 ug 530 € accurate-monoclonals human
YSGSPA815 Heat Shock Contituitive 70 (HSC70), Heat Shock Protein 73 (Hsp73), ~73kD, native/denatured, Clone: 1B5, Rat Mouse Monoclonal antibody-Hamster, Human, Mouse, Rat, Bovine, Dog, Chicken, Guinea pig, Monkey, Rabbit, Sheep, Swine, Turtle; WB/IP/ICC/IHC/EIA/FACS/IEM 0.2mg 1641 € accurate-monoclonals sheep
YSGSPA822D Heat Shock Protein 70 (Hsp70), Heat Shock Cognate 70 (Hsc70), Inducible & Constitutive, ~72&73kD, Clone: BB70, Mouse Monoclonal antibody-Chicken, Human, Mouse, Rat, Beluga, Bovine, Dog, Drosophila, Euglena gracilis, Fish, Guinea pig, Hamster, Scallop, Monkey, Mussel, Swine, Tunicate, Rabbit, 50 ug 736 € accurate-monoclonals yeast
MBS622347 Heat Shock Protein 60, P. falciparum (HSP60, HSP-60, 60kD Heat Shock Protein Mitochondrial, 60kD Chaperonin, Chaperonin 60, Cpn60, GroEL, HuCHA60, HLD4, HSP65, HSPD1, Mitochondrial Matrix Protein P1, P60 Lymphocyte Protein, SPG13) Antibody 100ug 630 € MBS Polyclonals_1 human
MEDCLA337-01 Heat Shock Protein 70 (HSP70), Heat Shock Cognate Protein 70 (HSC70), Clone: 8B11, Mouse Monoclonal antibody-Hu,Ms,Rt; prfn/NO frzn, IH/WB 0.1000ul 428 € accurate-monoclonals mouse
MEDCLA337-1 Heat Shock Protein 70 (HSP70), Heat Shock Cognate Protein 70 (HSC70), Clone: 8B11, Mouse Monoclonal antibody-Hu,Ms,Rt; prfn/NO frzn, IH/WB 1000ul 1199 € accurate-monoclonals mouse
YSGSPA840D Heat Shock Protein 90 alpha (Hsp90α), Heat Shock Protein 86 (Hsp86), NO X w/β (Hsp84), free & complexed, ~90kD, Clone: 9D2, Rat Mouse Monoclonal antibody-Human, Chicken; WB/IP/ICC/IHC 50 ug 586 € accurate-monoclonals human
YSGSPA817C Heat Shock Contituitive 70 (HSC70), Plant Cystolic Heat Shock Cognate 70, ~70-75kD, Clone: 5B7, Mouse Monoclonal antibody-Plant; WB/IP 25 ug 623 € accurate-monoclonals plant
YSGSPA817E Heat Shock Contituitive 70 (HSC70), Plant Cystolic Heat Shock Cognate 70, ~70-75kD, Clone: 5B7, Mouse Monoclonal antibody-Plant; WB/IP 0.1mg 1262 € accurate-monoclonals plant
C251 Recombinant Human Heat Shock Protein β-11, HSPB11 (N-6His) 500 µg 1613 € novo human
CH63 Recombinant Human Heat Shock Protein β-2, , HSPB2, MKBP (C-6His) 500 µg 709 € novo human