Recombinant Human GABA Receptor-Associated Protein-Like 1, GABARAPL1 (N-6His)

Contact us
Catalog number: C269
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human GABA Receptor-Associated Protein-Like 1, GABARAPL1 (N-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GABARAPL1 is produced by our E, coli expression system and the target gene encoding Met1-Lys117 is expressed with a 6His tag at the N-terminus
Molecular Weight: 16, 2 kD
UniProt number: Q9H0R8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GABARAPL1 (N-6His), GABA Receptor-Associated Protein-Like 1
Short name: GABARAPL1 (N-6His), Recombinant GABA Receptor-Associated Protein-Like 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GABARAPL1 (N-6His), sapiens GABA Receptor-Associated Protein-Like 1, recombinant H
Alternative technique: rec
Identity: 4068
Gene: GABARAPL1 | More about : GABARAPL1
Long gene name: GABA type A receptor associated protein like 1
Synonyms gene name: GABA(A) receptor-associated protein like 1
Synonyms: gec1 APG8L ATG8L ATG8B
Locus: 12p13, 2
Discovery year: 1999-09-29
GenBank acession: AF087847
Entrez gene record: 23710
Pubmed identfication: 11414770 11374880
Classification: Autophagy related
Havana BLAST/BLAT: OTTHUMG00000168411

Related Products :

C269 Recombinant Human GABA Receptor-Associated Protein-Like 1, GABARAPL1 (N-6His) 1 mg 2283 € novo human
MBS619401 VGAT (Vesicular GABA Amino Acid Transporter, Vesicular GABA Transporter, bA122O1.1, GABA and Glycine Transporter, hVIAAT, Solute Carrier Family 32 (GABA Vesicular Transporter) Member 1, Solute Carrier Family 32 Member 1, SLC32A1, Vesicular Inhibitory Amin 100ul 713 € MBS Polyclonals_1 human
MBS622524 GABA(B) Receptor 1, phosphorylated (Ser923) (Gamma-aminobutyric Acid (GABA) B Receptor 1, Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA B Receptor 1, GABABR1, GABA-B-R1, GABA-BR1, GABBR1-3, Gb1, GBR1) (Azide Free) Antibody 100ul 685 € MBS Polyclonals_1 human
AE42866GU-48 ELISA test for Guinea pig Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) 1x plate of 48 wells 402 € abebio human
AE42866GU Guinea pig Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE42866GU-96 Guinea pig Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) ELISA Kit 1x plate of 96 wells 671 € abebio human
MBS611694 VGAT (solute carrier family 32 (GABA vesicular transporter) member 1, GABA and glycine transporter, SLC32A 1, Solute carrier family 32 member 1, VGAT, VIAAT, Vesicular GABA Amino Acid Transporter, Vesicular GABA transporter, Vesicular inhibitory amino aci 50ug 685 € MBS Polyclonals_1 human
MBS613784 PAEL Receptor (GPR37, G Protein Coupled Receptor 37, ETBR-LP-1, Endothelin B Receptor-like Protein 1, PAELR, Parkin-Associated Endothelin Receptor-Like Receptor) 50ug 724 € MBS Polyclonals_1 human
EKU08388 GABA-A Receptor Associated Protein Like Protein 2 (GABARAPL2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS613314 GABA Receptor A Associated Protein-like 2 (GABARAPL2, Ganglioside Expression Factor 2, MAP1 Light Chain 3 Related Protein) 50ug 625 € MBS Polyclonals_1 human
RP-0078H Recombinant Human ATG8 / GABARAPL1 Protein (His Tag) 500μg 346 € adv human
MBS611860 GABARAP L2 (Gamma-aminobutyric acid receptor-associated protein-like 2, GABA(A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, MAP1 light chain 3-related protein, ATG8, GATE16, GABARAPL2, 50ug 884 € MBS Polyclonals_1 human
GWB-P1206J GABARAPL1, 1-117aa, Recombinant Protein bulk Ask price € genways bulk human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS622089 BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, BAP2, Fas Ligand-associated Factor 3, FLAF3, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSP53, Ins Antibody 100ug 763 € MBS Polyclonals_1 human
C262 Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm1, LSM1 (C-6His) 50 µg 496 € novo human
C230 Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm4, LSM4 (N-6His) 10 µg 202 € novo human
CH32 Recombinant Human GABA(A) Receptor-Associated Protein, GABARAP (N-6His, C-Fc) 1 mg 2283 € novo human
GENTAUR-58be3118e4c04 Anti- GABA A Receptor Associated Protein, aa33-54 Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58be311955428 Anti- GABA A Receptor Associated Protein, aa33-54 Antibody 100ug 525 € MBS Polyclonals human
MBS623659 GABA B Receptor Associated Protein, subunit 2, aa42-54 Antibody 100ug 525 € MBS Polyclonals_1 human
GWB-BSP487 GABARAPL1 Human Protein bulk Ask price € genways bulk human
MBS619375 RAP80, CT (Receptor Associated Protein 80, Receptor-associated Protein 80, Nuclear Zinc Finger Protein RAP80, Retinoid X Receptor-interacting Protein, Retinoid X Receptor-interacting Protein 110, RIP110, Rxrip110, Ubiquitin Interaction Motif-containing 1, Antibody 100ug 558 € MBS Polyclonals_1 human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619414 SAP30L (Sin3-associated Protein 30-like, SAP30-like, FLJ11526, Histone Deacetylase Complex Subunit SAP30L, Sin3A-associated Protein p30-like Protein, Sin3 Corepressor Complex Subunit SAP30L, HCV Non-structural Protein 4A-transactivated Protein 2, NS4ATP2) Antibody 100ul 575 € MBS Polyclonals_1 human
LV165014 GABARAPL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV165015 GABARAPL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV165016 GABARAPL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV165017 GABARAPL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human