Recombinant Human Visinin-Like Protein 1, VILIP, VSNL1 (N-6His)

Contact us
Catalog number: C265
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Visinin-Like Protein 1, VILIP, VSNL1 (N-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Visinin-Like Protein 1 is produced by our E, coli expression system and the target gene encoding Met1-Lys191 is expressed with a 6His tag at the N-terminus
Molecular Weight: 24, 3 kD
UniProt number: P62760
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 20 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VILIP, VSNL1 (N-6His), Visinin-Like Protein 1
Short name: VILIP, VSNL1 (N-6His), Recombinant Visinin-Like Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VILIP, VSNL1 (N-6His), sapiens Visinin-Like Protein 1, recombinant H
Alternative technique: rec
Identity: 12722
Gene: VSNL1 | More about : VSNL1
Long gene name: visinin like 1
Synonyms: VILIP HPCAL3 HUVISL1 HLP3 VILIP-1
Synonyms name: hippocalcin-like protein 3
Locus: 2p24, 2
Discovery year: 1994-11-02
Entrez gene record: 7447
Pubmed identfication: 8530085 2202488
RefSeq identity: NM_003385
Classification: EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000090645

Related Products :

C265 Recombinant Human Visinin-Like Protein 1, VILIP, VSNL1 (N-6His) 1 mg 2283 € novo human
MBS622442 Visinin-like protein 1 (VSNL1, VILIP-1) 100ug 597 € MBS Polyclonals_1 human
MBS622841 Visinin-like protein 1 (VSNL1, VILIP-1) 100ug 575 € MBS Polyclonals_1 human
MBS248304 Anti-Human VILIP / VSNL1 Antibody 200ul 597 € MBS Polyclonals_1 human
MBS248508 Chicken Polyclonal (IgY) to Human VILIP / VSNL1 Antibody 0.05 ml 597 € MBS Polyclonals_1 human
GENTAUR-58bde8656f095 Mouse Monoclonal [clone 2D11] (IgG1) to Human VILIP / VSNL1 Antibody 0.05 ml 597 € MBS mono human
abx570658 Anti-Human Visinin Like Protein 1 (VSNL1) ELISA Kit inquire 50 € abbex human
DL-VSNL1-Hu Human Visinin Like Protein 1 VSNL1 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58be25752e367 Anti-Visinin-Like Protein 1 (VSNL1) 100ul 348 € MBS mono human
EKU08157 Visinin Like Protein 1 (VSNL1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GWB-5E0540 Recombinant Human Visinin-Like Protein-1 bulk Ask price € genways bulk human
GWB-604D1A Recombinant Human Visinin-Like Protein-1 His Tag bulk Ask price € genways bulk human
abx263044 Anti-Visinin-Like Protein-1 His Tag Protein (Recombinant) 1 mg 7662 € abbex human
abx260465 Anti-Visinin-Like Protein-1 Protein (Recombinant) 1 mg 2428 € abbex human
GWB-P1654C Visinin-like protein-1, 1-191 aa, Recombinant Protein bulk Ask price € genways bulk human
abx167842 Anti-Visinin Like Protein 1 (Recombinant) 100 μg 847 € abbex human
abx167846 Anti-Visinin Like Protein 1 (Recombinant) 10 μg 412 € abbex human
abx250910 Anti-Human Visinin-like protein 1 ELISA Kit 96 tests 659 € abbex human
abx128873 Anti-Visinin Like Protein 1 Antibody 100 μg 514 € abbex human
abx129596 Anti-Visinin Like Protein 1 Antibody 10 μg 282 € abbex human
AR09267PU-L anti-Visinin-like protein 1 / HLP3 (1-191) Antibody 0,5 mg 833 € acr human
AR09267PU-N anti-Visinin-like protein 1 / HLP3 (1-191) Antibody 0,1 mg 384 € acr human
CH22114-100 anti-Visinin-like protein 1 / HLP3 Antibody 0,1 ml 601 € acr human
MO22132-100 anti-Visinin-like protein 1 / HLP3 Antibody 0,1 ml 601 € acr human
AP11591PU-N anti-Visinin-like protein 1 / HLP3 (C-term) Antibody 0,4 ml 587 € acr human
AP54522PU-N anti-Visinin-like protein 1 / HLP3 (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58be2c3c5a131 Visinin-like Protein 1, Monoclonal Antibody, Mouse 100ul 498 € MBS mono mouse
MBS273500 Visinin-like 1 antibody 100ul 426 € MBS Polyclonals_1 human
abx153492 Anti-Human VSNL1 ELISA Kit 96 tests 934 € abbex human
LV356339 VSNL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human