Recombinant Human Phosphomannomutase 2, PMM2 (C-6His)

Contact us
Catalog number: C250
Price: 612 €
Supplier: abebio
Product name: Recombinant Human Phosphomannomutase 2, PMM2 (C-6His)
Quantity: 1x plate of 96 wells
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Phosphomannomutase 2 is produced by our E, coli expression system and the target gene encoding Met1-Ser246 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 29
UniProt number: O15305
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFSLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PMM2 (C-6His), Phosphomannomutase 2
Short name: PMM2 (C-6His), Recombinant Phosphomannomutase 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PMM2 (C-6His), sapiens Phosphomannomutase 2, recombinant H
Alternative technique: rec
Identity: 9115
Gene: PMM2 | More about : PMM2
Long gene name: phosphomannomutase 2
Synonyms gene: CDG1
Synonyms: CDGS CDG1a PMI PMI1
Synonyms name: phosphomannose isomerase 1 mannose-6-phosphate isomerase
Locus: 16p13, 2
Discovery year: 1997-05-22
GenBank acession: BC008310
Entrez gene record: 5373
Pubmed identfication: 9140401
RefSeq identity: NM_000303
Classification: HAD Asp-based non-protein phosphatases
Havana BLAST/BLAT: OTTHUMG00000129697
Locus Specific Databases: Congenital Disorders of Glycosylation pages

Related Products :

C250 Recombinant Human Phosphomannomutase 2, PMM2 (C-6His) 500 µg 1613 € novo human
RP-1235H Recombinant Human Phosphomannomutase 2 / PMM2 / CDG1 Protein (His Tag) 20μg 456 € adv human
AE26857HU-48 ELISA test for Human Phosphomannomutase 2 (PMM2) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bcc789b683f Human Phosphomannomutase 2 (PMM2) 100ug 1730 € MBS Recombinant Proteins human
GENTAUR-58bcc78a0ee57 Human Phosphomannomutase 2 (PMM2) 1000ug 1730 € MBS Recombinant Proteins human
GENTAUR-58bcc78a5a0f6 Human Phosphomannomutase 2 (PMM2) 100ug 2243 € MBS Recombinant Proteins human
GENTAUR-58bcc78ab26f1 Human Phosphomannomutase 2 (PMM2) 1000ug 2243 € MBS Recombinant Proteins human
AE26857HU-96 Human Phosphomannomutase 2 (PMM2) ELISA Kit 1x plate of 96 wells 612 € abebio human
C249 Recombinant Human Phosphomannomutase 1, PMM1 (C-6His) 500 µg 1613 € novo human
GWB-P1311K PMM2, 1-246aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP284 PMM2 Human Protein bulk Ask price € genways bulk human
LV266563 PMM2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR09665PU-L anti-PMM2 (1-246, His-tag) Antibody 0,5 mg 1138 € acr human
AR09665PU-N anti-PMM2 (1-246, His-tag) Antibody 0,1 mg 485 € acr human
AM50632PU-N anti-PMM2 Antibody 0,1 ml 500 € acr human
AM50632PU-S anti-PMM2 Antibody 50 Вµl 369 € acr human
GENTAUR-58be419c2a2cb Anti- PMM2 Antibody 100ug 393 € MBS Polyclonals human
abx929043 Anti-PMM2 siRNA 15 nmol 528 € abbex human
abx929044 Anti-PMM2 siRNA inquire 50 € abbex human
GWB-MX022D PMM2 antibody 1 vial 521 € genways human
GWB-MX023E PMM2 antibody 1 vial 521 € genways human
MBS415566 PMM2 Antibody 100ul 304 € MBS Polyclonals_1 human
MBS858592 PMM2 Antibody 100ug 370 € MBS Polyclonals_1 human
MBS276202 PMM2 antibody [N1C3] 100ul 426 € MBS Polyclonals_1 human
GWB-CE12F5 PMM2 Over-expression Lysate reagent 1 vial 463 € genways human
MBS128765 PMM2 Polyclonal Antibody 200ug 663 € MBS Polyclonals_1 human
GENTAUR-58bd1e5f134db Polistes major Mastoparan-like peptide PMM2 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd1e5f57cb9 Polistes major Mastoparan-like peptide PMM2 1000ug 2078 € MBS Recombinant Proteins human
AE26859HU-48 ELISA test for Human Phosphomannomutase 1 (PMM1) 1x plate of 48 wells 373 € abebio human
AE26859HU-96 Human Phosphomannomutase 1 (PMM1) ELISA Kit 1x plate of 96 wells 612 € abebio human