| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PCBD1 is produced by our E, coli expression system and the target gene encoding Ala2-Thr104 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
14, 2 kD |
| UniProt number: |
P61457 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM DTT, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PCBD1 (N-6His), PHS, -Carbinolamine Dehydratase, Pterin-4-&alpha |
| Short name: |
PCBD1 (N-6His), PHS, -Carbinolamine Dehydratase, Recombinant Pterin-4-&alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
PCBD1 (N-6His), PHS, sapiens Pterin-4-&alpha, -Carbinolamine Dehydratase, recombinant H |
| Alternative technique: |
rec |
| Identity: |
8646 |
| Gene: |
PCBD1 |
More about : PCBD1 |
| Long gene name: |
pterin-4 alpha-carbinolamine dehydratase 1 |
| Synonyms gene: |
DCOH PCBD |
| Synonyms gene name: |
6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha |
| Synonyms: |
PCD |
| Synonyms name: |
Pterin-4a-carbinolamine dehydratase (dimerization cofactor of hepatic nuclear factor 1-alpha) pterin-4-alpha carbinolamine dehydratase dimerizing cofactor for HNF1 |
| Locus: |
10q22, 1 |
| Discovery year: |
1993-06-08 |
| GenBank acession: |
BC006324 |
| Entrez gene record: |
5092 |
| Pubmed identfication: |
8486378 |
| RefSeq identity: |
NM_000281 |
| Havana BLAST/BLAT: |
OTTHUMG00000018417 |
| Locus Specific Databases: |
BIOMDBdb: Database of Mutations Causing BH4 Deficiencies and other PND |