Recombinant Human PAF-AH subunit β, PAFAHB (C-6His)

Contact us
Catalog number: C244
Price: 717 €
Supplier: abbex
Product name: Recombinant Human PAF-AH subunit β, PAFAHB (C-6His)
Quantity: 30 nmol
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human PAF-AH subunit beta is produced by our E, coli expression system and the target gene encoding Ser2-Ala229 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 6 kD
UniProt number: P68402
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIAVEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PAFAHB (C-6His), PAF-AH subunit &beta
Short name: PAFAHB (C-6His), Recombinant PAF-AH subunit &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: PAFAHB (C-6His), sapiens PAF-AH functionnal sequence &beta, recombinant H
Alternative technique: rec

Related Products :

C244 Recombinant Human PAF-AH subunit β, PAFAHB (C-6His) 500 µg 1613 € novo human
MBS623526 Lissencephaly-1 (LIS1, LIS-1, MDCR, Miller-Dieker Syndrome, MDS, PAF Acetylhydrolase 45kD Subunit, PAF-AH 45kD Subunit, PAFAH alpha, PAF-AH alpha, PAFAHA, PAFAH, Platelet-activating Factor Acetylhydrolase IB Subunit alpha, PAFAH1B1) Antibody 50ug 680 € MBS Polyclonals_1 human
C624 Recombinant Human PAF-AH, PLA2G7 (C-6His) 50 µg 496 € novo human
RP-0953H Recombinant Human KIAA0101 / p15 / PAF Protein (His Tag) 10μg 572 € adv human
GWB-BIG0F7 Recombinant Human PAF-AH bulk Ask price € genways bulk human
GENTAUR-58bdae2de2c3c Drosophila melanogaster Platelet-activating factor acetylhydrolase IB subunit beta homolog (Paf-AHalpha) 100ug 1680 € MBS Recombinant Proteins drosophila
GENTAUR-58bdae2e41cd8 Drosophila melanogaster Platelet-activating factor acetylhydrolase IB subunit beta homolog (Paf-AHalpha) 1000ug 1680 € MBS Recombinant Proteins drosophila
GENTAUR-58bdae2e98dda Drosophila melanogaster Platelet-activating factor acetylhydrolase IB subunit beta homolog (Paf-AHalpha) 100ug 2194 € MBS Recombinant Proteins drosophila
GENTAUR-58bdae2f17655 Drosophila melanogaster Platelet-activating factor acetylhydrolase IB subunit beta homolog (Paf-AHalpha) 1000ug 2194 € MBS Recombinant Proteins drosophila
ZR-40-128 PAF-AH Recombinant Protein 0.005 mg 256 € Zyagen human
MBS612503 Lissencephaly-1 (LIS-1, MDCR, Miller-Dieker Syndrome, MDS, PAF Acetylhydrolase 45kD Subunit, PAFAH 45kD Subunit, PAFAH alpha, PAFAH1B1, Platelet Activating Factor Acetylhydrolase Isoform Ib alpha Subunit, PAFAHA, SBH, Subcortical Band Heterotopia, ILS, Is Antibody 100ul 785 € MBS Polyclonals_1 human
abx152623 Anti-Human PAF ELISA Kit inquire 50 € abbex human
abx575171 Anti-Human Platelet Activating Factor (PAF) ELISA Kit inquire 50 € abbex human
AE34702HU-48 ELISA test for Human Lyso-platelet activating factor (lyso-PAF) 1x plate of 48 wells 402 € abebio human
AE28813HU-48 ELISA test for Human Platelet activating factor (PAF) 1x plate of 48 wells 402 € abebio human
AE34702HU Human Lyso-platelet activating factor (lyso-PAF) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE34702HU-96 Human Lyso-platelet activating factor (lyso-PAF) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE28813HU Human Platelet activating factor (PAF) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE28813HU-96 Human Platelet activating factor (PAF) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-PAF-Hu Human Platelet Activating Factor PAF ELISA Kit 96T 846 € DL elisas human
abx575731 Anti-Cow Platelet Activating Factor (PAF) ELISA Kit inquire 50 € abbex cow
abx575730 Anti-Monkey Platelet Activating Factor (PAF) ELISA Kit 96 tests 876 € abbex monkey
abx575727 Anti-Mouse Platelet Activating Factor (PAF) ELISA Kit 96 tests 746 € abbex mouse
AR51128PU-N anti-PAF (1-111, His-tag) Antibody 0,25 mg 1413 € acr human
AR51128PU-S anti-PAF (1-111, His-tag) Antibody 50 Вµg 587 € acr human
GENTAUR-58be3dade89b2 Anti- PAF Antibody 100ug 370 € MBS Polyclonals human
abx150368 Anti-PAF ELISA Kit 96 tests 978 € abbex human
GENTAUR-58be5adbbceb2 Anti-PAF (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx927618 Anti-PAF siRNA inquire 50 € abbex human
abx927619 Anti-PAF siRNA 30 nmol 717 € abbex human