Recombinant Human Nucleoside Diphosphate Kinase A, NDPKA (N-6His)

Contact us
Catalog number: C241
Price: 1995 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Nucleoside Diphosphate Kinase A, NDPKA (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Nucleoside Diphosphate Kinase A is produced by our E, coli expression system and the target gene encoding Met1-Glu152 is expressed with a 6His tag at the N-terminus
Molecular Weight: 19, 3 kD
UniProt number: P15531
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 10% Glycerol, pH 7, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NDPKA (N-6His), Nucleoside Diphosphate Kinase A
Short name: NDPKA (N-6His), Recombinant Nucleoside Diphosphate Kinase A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NDPKA (N-6His), sapiens Nucleoside Diphosphate phosphorylation catalyst A, recombinant H
Alternative technique: rec
Identity: 7849
Gene: NME1 | More about : NME1
Long gene name: NME/NM23 nucleoside diphosphate kinase 1
Synonyms gene name: non-metastatic cells 1, protein (NM23A) expressed in
Synonyms: NM23 NM23-H1 NDPKA
Locus: 17q21, 33
Discovery year: 1991-07-26
GenBank acession: AL360191 X17620
Entrez gene record: 4830
Pubmed identfication: 8270257 19852809
RefSeq identity: NM_000269
Classification: NME/NM23 family
Havana BLAST/BLAT: OTTHUMG00000137474

Related Products :

C241 Recombinant Human Nucleoside Diphosphate Kinase A, NDPKA (N-6His) 500 µg 1613 € novo human
MBS623716 Nucleoside Diphosphate Kinase D, NT (NDPKD, NDPK-D, NM23D, NM23H4, nm23-H4, NME4, Nucleoside Diphosphate Kinase Mitochondrial, NDP Kinase Mitochondrial, NDK) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS624216 MAP4K1, phosphorylated (Ser171) (Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1, Hematopoietic Progenitor Kinase, HPK1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623463 GLK, CT (Germinal Center Kinase Related Protein Kinase, Mitogen-activated Protein Kinase Kinase Kinase Kinase 3, MAP4K3, MAPKKKK3, MAPK/ERK Kinase Kinase Kinase 3, MEK Kinase Kinase 3, MEKKK 3, RAB8IPL1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623809 Nucleoside Diphosphate Kinase 7, NT (NDP Kinase 7, NDK 7, FLJ37194, nm23-H7, NME7) 200ul 603 € MBS Polyclonals_1 human
MBS616935 Nucleoside Diphosphate Kinase A (NME1, NDP Kinase A, NDK A, Tumor Metastatic Process- Associated Protein, Metastasis Inhibition Factor nm23, nm23-H1, Granzyme A-Activated DNase, GAAD, NDPKA, NM23) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS616639 Germinal Center Kinase (GC Kinase, GCK, B Lymphocyte Serine/threonine-protein Kinase, BL44, Mitogen-activated Protein Kinase Kinase Kinase Kinase 2, MAP4K2, MAPK/ERK Kinase Kinase Kinase 2, MEK Kinase Kinase 2, MEKKK 2, Rab8-interacting Protein, RAB8IP) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS621988 MAP3K5, CT (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) Antibody 100ug 558 € MBS Polyclonals_1 human
MBS613793 Uridine Monophosphate Kinase 2 (UMPK, Uridine-Cytidine Kinase 2, Nucleoside Phosphate Kinase, NMP Kinase) Antibody 50ug 625 € MBS Polyclonals_1 human
abx250884 Anti-Human Nucleoside diphosphate kinase A ELISA Kit inquire 50 € abbex human
AE30860HU-48 ELISA test for Human Putative nucleoside diphosphate kinase (NME2P1) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bccbdc94de0 Human Nucleoside diphosphate kinase B (NME2) 100ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bccbdcd7ad9 Human Nucleoside diphosphate kinase B (NME2) 1000ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bccbdd33c98 Human Nucleoside diphosphate kinase B (NME2) 100ug 2000 € MBS Recombinant Proteins human
GENTAUR-58bccbdd7d511 Human Nucleoside diphosphate kinase B (NME2) 1000ug 2000 € MBS Recombinant Proteins human
GENTAUR-58b9a82c7485c Human Nucleoside diphosphate kinase, mitochondrial (NME4) 100ug 1509 € MBS Recombinant Proteins human
GENTAUR-58b9a82cec32f Human Nucleoside diphosphate kinase, mitochondrial (NME4) 1000ug 1509 € MBS Recombinant Proteins human
GENTAUR-58b9a82d5173d Human Nucleoside diphosphate kinase, mitochondrial (NME4) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58b9a82dbd3b3 Human Nucleoside diphosphate kinase, mitochondrial (NME4) 1000ug 2011 € MBS Recombinant Proteins human
GENTAUR-58ba23201b27a Human Nucleoside diphosphate kinase, mitochondrial (NME4) 100ug 1509 € MBS Recombinant Proteins human
GENTAUR-58ba232097930 Human Nucleoside diphosphate kinase, mitochondrial (NME4) 1000ug 1509 € MBS Recombinant Proteins human
GENTAUR-58ba232153de0 Human Nucleoside diphosphate kinase, mitochondrial (NME4) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58ba2321d480b Human Nucleoside diphosphate kinase, mitochondrial (NME4) 1000ug 2011 € MBS Recombinant Proteins human
AE30860HU-96 Human Putative nucleoside diphosphate kinase (NME2P1) ELISA Kit 1x plate of 96 wells 612 € abebio human
MEDCLA118 Nucleoside Diphosphate Kinase A (NDPK-A), nm23, Clone: 37.6, Mouse Monoclonal antibody-Human, (low X w/NDPK-B); paraffin 1000ul 1453 € accurate-monoclonals human
MEDCLA153 Nucleoside Diphosphate Kinase A (NDPK-A), nm23 (NO X w/nm23-H2), Clone: NM301, Mouse Monoclonal antibody-Human, paraffin 1000ul 1453 € accurate-monoclonals human
GENTAUR-58b9d648e953f Acaryochloris marina Nucleoside diphosphate kinase (ndk) 100ug 1492 € MBS Recombinant Proteins human
GENTAUR-58b9d6492c283 Acaryochloris marina Nucleoside diphosphate kinase (ndk) 1000ug 1492 € MBS Recombinant Proteins human
GENTAUR-58b9d649867bc Acaryochloris marina Nucleoside diphosphate kinase (ndk) 100ug 1995 € MBS Recombinant Proteins human