Recombinant Human NHP2-Like Protein 1, NHP2L1 (N-6His)

Contact us
Catalog number: C240
Price: 2006 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human NHP2-Like Protein 1, NHP2L1 (N-6His)
Quantity: 100ug
Other quantities: 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human NHP2L1 is produced by our E, coli expression system and the target gene encoding Met1-Val128 is expressed with a 6His tag at the N-terminus
Molecular Weight: 16, 3 kD
UniProt number: P55769
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 600 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NHP2L1 (N-6His), NHP2-Like Protein 1
Short name: NHP2L1 (N-6His), Recombinant NHP2-Like Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NHP2L1 (N-6His), sapiens NHP2-Like Protein 1, recombinant H
Alternative technique: rec
Identity: 7819
Gene: SNU13 | More about : SNU13
Long gene name: SNU13 homolog, small nuclear ribonucleoprotein (U4/U6, U5)
Synonyms gene: SSFA1 NHP2L1
Synonyms gene name: cerevisiae) , cerevisiae)-like 1 sperm specific antigen 1 NHP2 non-histone chromosome protein 2-like 1 (S, non-histone chromosome protein 2 (S
Synonyms: FA-1 SPAG12 SNRNP15-5 15, 5K
Synonyms name: small nuclear ribonucleoprotein 15, 5kDa (U4/U6, U5)
Locus: 22q13, 2
Discovery year: 1995-06-14
Entrez gene record: 4809
Pubmed identfication: 8978773 17412961 17636026
RefSeq identity: NM_001003796
Havana BLAST/BLAT: OTTHUMG00000151189
Locus Specific Databases: LRG_1102

Related Products :

C240 Recombinant Human NHP2-Like Protein 1, NHP2L1 (N-6His) 500 µg 1613 € novo human
MBS611487 NHP2 Non-Histone Chromosome Protein 2-like 1 (High Mobility Group-like Nuclear Protein 2 Homolog 1, NHP2L1) Antibody 50ug 625 € MBS Polyclonals_1 human
AE58218BO Bovine NHP2-like protein 1 (NHP2L1) ELISA Kit 48 wells plate 500 € ab-elisa elisas bovine
AE58218BO-96 Bovine NHP2-like protein 1 (NHP2L1) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE58218BO-48 ELISA test for Bovine NHP2-like protein 1 (NHP2L1) 1x plate of 48 wells 402 € abebio bovine
CG85 Recombinant Human Nucleolar Protein Family A Member 2, NHP2, NOLA2 (N-6His) 50 µg 339 € novo human
abx262453 Anti-NHP2 Non-Histone Chromosome Protein 2-Like Protein (Recombinant) 1 mg 6662 € abbex human
GWB-P1226D NHP2L1, 1-128aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP553 NHP2L1 Human Protein bulk Ask price € genways bulk human
LV238860 NHP2L1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx261896 Anti-NHP2 Ribonucleoprotein Homolog Protein (Recombinant) 1 mg 4675 € abbex human
GWB-P1173C NHP2, 1-153aa, Recombinant Protein bulk Ask price € genways bulk human
AR09752PU-L anti-NHP2L1 (1-128, His-tag) Antibody 0,25 mg 1500 € acr human
AR09752PU-N anti-NHP2L1 (1-128, His-tag) Antibody 50 Вµg 587 € acr human
GENTAUR-58be4dff39f07 Anti- NHP2L1 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be4dff9a414 Anti- NHP2L1 Antibody 50ug 365 € MBS Polyclonals human
XW-7997 anti-NHP2L1 Antibody 0.05 mg 180 € proscience human
abx903560 Anti-NHP2L1 siRNA inquire 50 € abbex human
abx925887 Anti-NHP2L1 siRNA inquire 50 € abbex human
abx925888 Anti-NHP2L1 siRNA inquire 50 € abbex human
GWB-BSP552 NHP2 Human Protein bulk Ask price € genways bulk human
LV238854 NHP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58be588210569 Anti- NHP2 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be588296d9a Anti- NHP2 Antibody 50ug 365 € MBS Polyclonals human
abx925889 Anti-NHP2 siRNA 15 nmol 528 € abbex human
abx925890 Anti-NHP2 siRNA 30 nmol 717 € abbex human
GENTAUR-58bdac021af6b Mouse H/ACA ribonucleoprotein complex subunit 2 (Nhp2) 100ug 1503 € MBS Recombinant Proteins mouse
GENTAUR-58bdac0284554 Mouse H/ACA ribonucleoprotein complex subunit 2 (Nhp2) 1000ug 1503 € MBS Recombinant Proteins mouse
GENTAUR-58bdac02ed92f Mouse H/ACA ribonucleoprotein complex subunit 2 (Nhp2) 100ug 2006 € MBS Recombinant Proteins mouse