Recombinant Human Inositol Monophosphatase 1, IMPA1, IIMPase 2 (N-6His)

Contact us
Catalog number: C234
Price: 485 €
Supplier: acr
Product name: Recombinant Human Inositol Monophosphatase 1, IMPA1, IIMPase 2 (N-6His)
Quantity: 50 Вµg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Inositol Monophosphatase 1 is produced by our E, coli expression system and the target gene encoding Met1-Asp277 is expressed with a 6His tag at the N-terminus
Molecular Weight: 3 kD, 32
UniProt number: P29218
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 25, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IIMPase 2 (N-6His), IMPA1, Inositol Monophosphatase 1
Short name: IIMPase 2 (N-6His), IMPA1, Recombinant Inositol Monophosphatase 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: IIMPase 2 (N-6His), IMPA1, sapiens Inositol Monophosphatase 1, recombinant H
Alternative technique: rec
Identity: 6050
Gene: IMPA1 | More about : IMPA1
Long gene name: inositol monophosphatase 1
Synonyms gene: IMPA
Synonyms gene name: inositol(myo)-1(or 4)-monophosphatase 1
Synonyms name: myo-inositol monophosphatase 1
Locus: 8q21, 13
Discovery year: 1993-08-26
Entrez gene record: 3612
Pubmed identfication: 1377913
RefSeq identity: NM_005536
Classification: Phosphoinositide phosphatases
Havana BLAST/BLAT: OTTHUMG00000164682

Related Products :

C234 Recombinant Human Inositol Monophosphatase 1, IMPA1, IIMPase 2 (N-6His) 1 mg 2283 € novo human
AR09675PU-L anti-Inositol monophosphatase / IMPA1 (1-277, His-tag) Antibody 0,5 mg 1138 € acr human
AR09675PU-N anti-Inositol monophosphatase / IMPA1 (1-277, His-tag) Antibody 0,1 mg 485 € acr human
AE38120PI-48 ELISA test for Pig Inositol monophosphatase 1 (IMPA1) 1x plate of 48 wells 402 € abebio pig
GENTAUR-58bccee75a852 Mouse Inositol monophosphatase 1 (Impa1) 100ug 1812 € MBS Recombinant Proteins mouse
GENTAUR-58bccee7a776e Mouse Inositol monophosphatase 1 (Impa1) 1000ug 1812 € MBS Recombinant Proteins mouse
GENTAUR-58bccee7ea3c9 Mouse Inositol monophosphatase 1 (Impa1) 100ug 2326 € MBS Recombinant Proteins mouse
GENTAUR-58bccee82de8d Mouse Inositol monophosphatase 1 (Impa1) 1000ug 2326 € MBS Recombinant Proteins mouse
GENTAUR-58bb905e5ef97 Pig Inositol monophosphatase 1 (IMPA1) 100ug 1812 € MBS Recombinant Proteins pig
GENTAUR-58bb905eac8e3 Pig Inositol monophosphatase 1 (IMPA1) 1000ug 1812 € MBS Recombinant Proteins pig
GENTAUR-58bb905f03184 Pig Inositol monophosphatase 1 (IMPA1) 100ug 2326 € MBS Recombinant Proteins pig
GENTAUR-58bb905f4c972 Pig Inositol monophosphatase 1 (IMPA1) 1000ug 2326 € MBS Recombinant Proteins pig
AE38120PI-96 Pig Inositol monophosphatase 1 (IMPA1) ELISA Kit 1x plate of 96 wells 671 € abebio pig
CE24 Recombinant Human Inositol Monophosphatase 2, IMPase 2 (N-6His) 1 mg 2283 € novo human
abx261010 Anti-Inositol Monophosphatase Domain Containing 1 Protein (Recombinant) 5 µg 238 € abbex human
MBS621086 SLC5A3, CT (Solute Carrier Family 5 Member 3, Na(+)/myo-inositol Cotransporter, Sodium/myo-inositol Cotransporter, SMIT, Sodium/myo-inositol Cotransporter 1) Antibody 50ug 928 € MBS Polyclonals_1 human
RP-1658H Recombinant Human IMP1 / IMPA1 Protein (His Tag) 20μg 572 € adv human
abx250846 Anti-Human Inositol monophosphatase 1 ELISA Kit 96 tests 659 € abbex human
abx253932 Anti-Human Inositol monophosphatase 2 ELISA Kit 96 tests 659 € abbex human
GENTAUR-58b828020a2ca Human Inositol monophosphatase 2 (IMPA2) 100ug 1840 € MBS Recombinant Proteins human
GENTAUR-58b828026cf68 Human Inositol monophosphatase 2 (IMPA2) 1000ug 1840 € MBS Recombinant Proteins human
GENTAUR-58b82802bd8b9 Human Inositol monophosphatase 2 (IMPA2) 100ug 2354 € MBS Recombinant Proteins human
GENTAUR-58b8280325329 Human Inositol monophosphatase 2 (IMPA2) 1000ug 2354 € MBS Recombinant Proteins human
GENTAUR-58b8531127903 Human Inositol monophosphatase 2 (IMPA2) 100ug 1840 € MBS Recombinant Proteins human
GENTAUR-58b85311b9883 Human Inositol monophosphatase 2 (IMPA2) 1000ug 1840 € MBS Recombinant Proteins human
GENTAUR-58b85312360d8 Human Inositol monophosphatase 2 (IMPA2) 100ug 2354 € MBS Recombinant Proteins human
GENTAUR-58b8531296a5a Human Inositol monophosphatase 2 (IMPA2) 1000ug 2354 € MBS Recombinant Proteins human
GWB-P1301A IMPA1, 1-277aa, Recombinant Protein bulk Ask price € genways bulk human
AR09853PU-L anti-Inositol monophosphatase 2 / IMPA2 (1-288, His-tag) Antibody 0,25 mg 1138 € acr human
AR09853PU-N anti-Inositol monophosphatase 2 / IMPA2 (1-288, His-tag) Antibody 50 Вµg 485 € acr human