Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF

Contact us
Catalog number: C226
Price: 846 €
Supplier: DL elisas
Product name: Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 202€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GDNF is produced by our E, coli expression system and the target gene encoding Ser78-Ile211 is expressed
Molecular Weight: 1 kD, 15
UniProt number: P39905
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 25, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GDNF, Glial Line-Derived Neurotrophic Factor
Short name: GDNF, Recombinant Glial Cell Line-Derived Neurotrophic Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: glial cell derived neurotrophic factor, sapiens Glial cellular Line-Derived Neurotrophic Factor, recombinant H
Alternative technique: rec
Alternative to gene target: ATF1 and ATF2 and HFB1-GDNF and HSCR3, BT, Extracellular, GDNF and IDBG-17169 and ENSG00000168621 and 2668, Gdnf and IDBG-128378 and ENSMUSG00000022144 and 14573, protein homodimerization activity, this GO :0001656 and metanephros development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001759 and organ induction and biological process this GO :0001941 and postsynaptic membrane organization and biological process this GO :0003337 and mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0021784 and postganglionic parasympathetic nervous system development and biological process this GO :0030432 and peristalsis and biological process this GO :0031175 and neuron projection development and biological process this GO :0032770 and positive regulation of monooxygenase activity and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048255 and mRNA stabilization and biological process this GO :0048484 and enteric nervous system development and biological process this GO :0048485 and sympathetic nervous system development and biological process this GO :0051584 and regulation of dopamine uptake involved in synaptic transmission and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060688 and regulation of morphogenesis of a branching structure and biological process this GO :0072107 and positive regulation of ureteric bud formation and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, 58072 and IDBG-630047 and ENSBTAG00000005176 and 386587, glial cell derived neurotrophic factor
Identity: 4232
Gene: GDNF | More about : GDNF
Long gene name: glial cell derived neurotrophic factor
Synonyms: ATF1 ATF2 HFB1-GDNF
Synonyms name: astrocyte-derived trophic factor glial cell line derived neurotrophic factor glial derived neurotrophic factor
Locus: 5p13, 2
Discovery year: 1995-05-04
Entrez gene record: 2668
Pubmed identfication: 8493557
RefSeq identity: NM_000514
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000090809

Related Products :

MBS612853 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) 100ul 652 € MBS Polyclonals_1 human
MBS613517 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) 50ug 652 € MBS Polyclonals_1 human
MBS618177 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS622722 GFR alpha1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1, GDNF Family Receptor alpha 1, GDNF Receptor alpha 1, GFR-alpha-1, GFRalpha1, GFRA1, GDNF Receptor alpha, GDNFR alpha, GDNFR-alpha, GDNFRa, GDNFR, GPI-linked Anchor Protein, MGC23045 Antibody 100ug 857 € MBS Polyclonals_1 human
C226 Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF 1 mg 2283 € novo human
CD08 Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF (C-Fc-6His) 10 µg 156 € novo human
AE42365HU-48 ELISA test for Human Glial cell line-derived neurotrophic factor (GDNF) 1x plate of 48 wells 373 € abebio human
AE42365HU Human Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE42365HU-96 Human Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-GDNF-Hu Human Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdc86634507 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdc9f7bea45 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc9f99e94a Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdcb70c74ec Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdce0e2ea73 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdce0e8efa2 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd50933bc6 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdda3d59311 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdda78f3690 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bddaecdc995 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bddaed3837c Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 50ug 343 € MBS Polyclonals human
GENTAUR-58bddd04e4b36 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 553 € MBS Polyclonals human
AE42364MO-48 ELISA test for Mouse Glial cell line-derived neurotrophic factor (GDNF) 1x plate of 48 wells 360 € abebio mouse
EKU04375 Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA kit 1 plate of 96 wells 667 € Biomatik ELISA kits human
EKU04376 Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU04377 Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA kit 1 plate of 96 wells 720 € Biomatik ELISA kits human
AE42364MO Mouse Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 48 wells plate 465 € ab-elisa elisas mouse
AE42364MO-96 Mouse Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 1x plate of 96 wells 587 € abebio mouse
DL-GDNF-Mu Mouse Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit 96T 869 € DL elisas mouse
DL-GDNF-Ra Rat Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit 96T 846 € DL elisas rat