| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human FABP6 is produced by our E, coli expression system and the target gene encoding Met1-Ala128 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
16, 6 kD |
| UniProt number: |
P51161 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
0, 50% Glycerol, pH 8, 2 um filtered solution of 20 mM TrisHCl, 5 mM DTT, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FABP6, I-BABP (N-6His), Fatty Acid-Binding Protein 6 |
| Short name: |
FABP6, I-BABP (N-6His), Recombinant Fatty Acid-Binding Protein 6 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
FABP6, I-BABP (N-6His), sapiens Fatty Acid-Binding Protein 6, recombinant H |
| Alternative technique: |
rec |
| Identity: |
3561 |
| Gene: |
FABP6 |
More about : FABP6 |
| Long gene name: |
fatty acid binding protein 6 |
| Synonyms gene name: |
fatty acid binding protein 6, ileal |
| Synonyms: |
I-15P ILLBP I-BAP ILBP3 I-BABP ILBP I-BALB |
| Synonyms name: |
illeal lipid-binding protein ileal bile acid binding protein gastrotropin |
| Locus: |
5q33, 3 |
| Discovery year: |
1997-09-12 |
| GenBank acession: |
U19869 |
| Entrez gene record: |
2172 |
| Pubmed identfication: |
7894165 7619861 |
| RefSeq identity: |
NM_001040442 |
| Classification: |
Fatty acid binding protein family |
| Havana BLAST/BLAT: |
OTTHUMG00000130329 |