Recombinant Human Eukaryotic Translation Initiation Factor 1B, EIF1B (N-6His)

Contact us
Catalog number: C220
Price: 741 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Eukaryotic Translation Initiation Factor 1B, EIF1B (N-6His)
Quantity: 0.28 ml
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human EIF1B is produced by our E, coli expression system and the target gene encoding Met1-Phe113 is expressed with a 6His tag at the N-terminus
Molecular Weight: 15 kD
UniProt number: O60739
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 500 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EIF1B (N-6His), Eukaryotic Translation Initiation Factor 1B
Short name: EIF1B (N-6His), Recombinant Eukaryotic Translation Initiation Factor 1B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EIF1B (N-6His), sapiens Eukaryotic Translation Initiation Factor 1B, recombinant H
Alternative technique: rec
Identity: 30792
Gene: EIF1B | More about : EIF1B
Long gene name: eukaryotic translation initiation factor 1B
Synonyms: GC20
Locus: 3p22, 1
Discovery year: 2006-02-02
GenBank acession: BC006996
Entrez gene record: 10289
Pubmed identfication: 7904817
RefSeq identity: NM_005875
Havana BLAST/BLAT: OTTHUMG00000131388

Related Products :

C220 Recombinant Human Eukaryotic Translation Initiation Factor 1B, EIF1B (N-6His) 10 µg 202 € novo human
MBS620265 Eukaryotic Translation Initiation Factor 5A (eIF 5A, eIF-5A, eIF5A Protein Synthesis Initiation Factor, Eukaryotic Initiation Factor 5A Isoform 1, Eukaryotic Translation Initiation Factor 5A-1, eIF 5A1, eIF5A1, eIF-5A1, eIF-5A-1, eIF5AI, eIF 4D, eIF-4D, M Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623427 EIF2A, phosphorylated (Ser49) (Eukaryotic Translation Initiation Factor 2A, eIF-2A, 65kD Eukaryotic Translation Initiation Factor 2A, CDA02, MSTP004, MSTP089) Antibody 50ug 481 € MBS Polyclonals_1 human
MBS623105 EIF3S7 (Eukaryotic Translation Initiation Factor 3 Subunit 7, Eukaryotic Translation Initiation Factor 3 Subunit D, eIF3D, eIF3-p66, eIF3-zeta) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS610424 eIF3S8 (eIF3-S8, eIF3p110, eIF3c, eukaryotic translation initiation factor 3, subunit 8, eukaryotic translation initiation factor 3, 110kDa subunit, eukaryotic translation initiation factor 3, subunit c) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS620452 Eukaryotic Translation Initiation Factor 4G1 (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4 gamma 1, eIF4GI, eIF-4G 1, eIF-4G1, eIF-4G-1, EIF4 gamma, DKFZp686A1451, EIF4F, p220) Antibody 100ul 785 € MBS Polyclonals_1 human
GENTAUR-58b9a6ca9f26c Human Eukaryotic translation initiation factor 1b (EIF1B) 100ug 1398 € MBS Recombinant Proteins human
GENTAUR-58b9a6cb04bcb Human Eukaryotic translation initiation factor 1b (EIF1B) 1000ug 1398 € MBS Recombinant Proteins human
GENTAUR-58b9a6cb8df55 Human Eukaryotic translation initiation factor 1b (EIF1B) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58b9a6cbe42fc Human Eukaryotic translation initiation factor 1b (EIF1B) 1000ug 1901 € MBS Recombinant Proteins human
GENTAUR-58ba216b6b48d Human Eukaryotic translation initiation factor 1b (EIF1B) 100ug 1398 € MBS Recombinant Proteins human
GENTAUR-58ba216c0bd71 Human Eukaryotic translation initiation factor 1b (EIF1B) 1000ug 1398 € MBS Recombinant Proteins human
GENTAUR-58ba216d010a3 Human Eukaryotic translation initiation factor 1b (EIF1B) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58ba216da3edd Human Eukaryotic translation initiation factor 1b (EIF1B) 1000ug 1901 € MBS Recombinant Proteins human
AE45946PI-48 ELISA test for Pig Eukaryotic translation initiation factor 1b (EIF1B) 1x plate of 48 wells 402 € abebio pig
AE45946PI-96 Pig Eukaryotic translation initiation factor 1b (EIF1B) ELISA Kit 1x plate of 96 wells 671 € abebio pig
MBS623985 EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621000 eIF4G (eukaryotic translation initiation factor 4 gamma, 1, KFZp686A1451, EIF4F, EIF4G, eIF-4G1, eIF-4G 1, eIF-4-gamma 1, EIF4GI, Eukaryotic translation initiation factor 4 gamma 1, p220) Antibody 100ul 597 € MBS Polyclonals_1 human
CG95 Recombinant Human Eukaryotic Translation Initiation Factor 5A-2, EIF5A2 (N-6His) 1 mg 2283 € novo human
MBS615207 Eukaryotic Translation Initiation Factor 5A, CT (eIF 5A, eIF5A Protein Synthesis Initiation Factor) Antibody 100ul 658 € MBS Polyclonals_1 human
MBS614162 Eukaryotic Translation Initiation Factor 5A2 (eIF 5A2, eIF5A2 Protein Synthesis Initiation Factor) Antibody 50ug 382 € MBS Polyclonals_1 human
MBS617935 Eukaryotic Translation Initiation Factor 5A2 (eIF 5A2, eIF5A2 Protein Synthesis Initiation Factor) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS614675 Protein Synthesis Initiation Factor 4E Binding Protein, (eIF-4EBP1, 4EBP-1, PHAS-I, Eukaryotic Translation Initiation Factor BP) 50ug 724 € MBS Polyclonals_1 human
MBS614188 Protein Synthesis Initiation Factor 4E Binding Protein, (eIF-4EBP1, 4EBP-1, PHAS-I, Eukaryotic Translation Initiation Factor BP) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS618297 Protein Synthesis Initiation Factor 4E Binding Protein, (eIF-4EBP1, 4EBP-1, PHAS-I, Eukaryotic Translation Initiation Factor BP) Antibody 50ug 641 € MBS Polyclonals_1 human
MBS618749 Protein Synthesis Initiation Factor 4E (eIF 4E, Eukaryotic Translation Initiation Factor) 0.05 ml 807 € MBS Polyclonals_1 human
MBS615503 Protein Synthesis Initiation Factor 4E (eIF 4E, Eukaryotic Translation Initiation Factor) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS616511 Protein Synthesis Initiation Factor 4E, phosphorylated (Ser209) (eIF 4E, Eukaryotic Translation Initiation Factor) 100ul 603 € MBS Polyclonals_1 human
MBS613829 Protein Synthesis Initiation Factor 4G, phosphorylated (Ser1108) (eIF 4G, Eukaryotic Translation Initiation Factor) 100ul 603 € MBS Polyclonals_1 human
MBS611688 4E Binding Protein 1 Antibody Kit (Protein Synthesis Initiation Factor 4E Binding Protein, eIF-4EBP1, PHAS-1, PHAS-I, Eukaryotic Translation Initiation Factor BP) 0.28 ml 741 € MBS Polyclonals_1 human