Recombinant Human EIF1A, X-Chromosomal, EIF1AX (N-6His)

Contact us
Catalog number: C219
Price: 1890 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human EIF1A, X-Chromosomal, EIF1AX (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human EIF1AX is produced by our E, coli expression system and the target gene encoding Met1-Ile144 is expressed with a 6His tag at the N-terminus
Molecular Weight: 18, 6 kD
UniProt number: P47813
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EIF1AX (N-6His), X-Chromosomal, EIF1A
Short name: EIF1AX (N-6His), X-Chromosomal, Recombinant EIF1A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EIF1AX (N-6His), X-Chromosomal, sapiens EIF1A, recombinant H
Alternative technique: rec
Identity: 3250
Gene: EIF1AX | More about : EIF1AX
Long gene name: X-linked , eukaryotic translation initiation factor 1A
Synonyms gene: EIF4C EIF1A
Synonyms gene name: X chromosome , eukaryotic translation initiation factor 1A
Synonyms: eIF-1A eIF-4C
Locus: Xp22, 12
Discovery year: 1991-03-04
GenBank acession: L18960
Entrez gene record: 1964
Pubmed identfication: 8106356 9381176
Havana BLAST/BLAT: OTTHUMG00000022704

Related Products :

C219 Recombinant Human EIF1A, X-Chromosomal, EIF1AX (N-6His) 1 mg 2283 € novo human
GWB-P1325L EIF1AX, 1-144aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP465 EIF1AX Human Protein bulk Ask price € genways bulk human
LV146559 EIF1AX Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV146560 EIF1AX Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV146561 EIF1AX Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV146562 EIF1AX Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV146564 EIF1AX Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV146563 EIF1AX Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
AR09651PU-L anti-EIF1AX (1-144, His-tag) Antibody 0,5 mg 1138 € acr human
AR09651PU-N anti-EIF1AX (1-144, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58bdfe93a4e9e Anti- EIF1AX Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfe9412588 Anti- EIF1AX Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be004fcf336 Anti- EIF1AX Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be005046f2e Anti- EIF1AX Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be50122477c Anti- EIF1AX Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be50127bef9 Anti- EIF1AX Antibody 50ug 365 € MBS Polyclonals human
abx915122 Anti-EIF1AX siRNA 30 nmol 717 € abbex human
abx915123 Anti-EIF1AX siRNA inquire 50 € abbex human
GWB-MQ299B EIF1AX antibody 1 vial 521 € genways human
GWB-446909 EIF1AX Over-expression Lysate reagent 1 x 1 vial 463 € genways human
abx915120 Anti-EIF1A siRNA 30 nmol 717 € abbex human
abx915121 Anti-EIF1A siRNA inquire 50 € abbex human
F53885-0.05ML EIF1A Antibody 0.05 ml 199 € NJS poly human
F53885-0.2ML EIF1A Antibody 0.2 ml 406 € NJS poly human
F53886-0.05ML EIF1A Antibody 0.05 ml 199 € NJS poly human
F53886-0.2ML EIF1A Antibody 0.2 ml 406 € NJS poly human
GENTAUR-58bcb7e1b3872 Metallosphaera sedula Translation initiation factor 1A (eIF1A) 100ug 1387 € MBS Recombinant Proteins human
GENTAUR-58bcb7e1eab01 Metallosphaera sedula Translation initiation factor 1A (eIF1A) 1000ug 1387 € MBS Recombinant Proteins human
GENTAUR-58bcb7e248237 Metallosphaera sedula Translation initiation factor 1A (eIF1A) 100ug 1890 € MBS Recombinant Proteins human