| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human DYNLL1 is produced by our E, coli expression system and the target gene encoding Met1-Gly89 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
12, 5 kD |
| UniProt number: |
P63167 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, 200 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
DYNLL1 (N-6His), Cytoplasmic Dynein Light Chain 1 |
| Short name: |
DYNLL1 (N-6His), Recombinant Cytoplasmic Dynein Light Chain 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
DYNLL1 (N-6His), sapiens Cytoplasmic Dynein Light epitope 1, recombinant H |
| Alternative technique: |
rec |
| Identity: |
15476 |
| Gene: |
DYNLL1 |
More about : DYNLL1 |
| Long gene name: |
dynein light chain LC8-type 1 |
| Synonyms gene: |
DNCL1 |
| Synonyms gene name: |
cytoplasmic, dynein, light polypeptide 1 |
| Synonyms: |
hdlc1 DLC1 PIN LC8 DLC8 |
| Locus: |
12q24, 31 |
| Discovery year: |
2002-12-18 |
| GenBank acession: |
U32944 |
| Entrez gene record: |
8655 |
| Pubmed identfication: |
8628263 8864115 16260502 |
| RefSeq identity: |
NM_003746 |
| Classification: |
Dyneins, cytoplasmic |
| Havana BLAST/BLAT: |
OTTHUMG00000169368 |