Recombinant Human Cytochrome b5, CYB5A (N-6His)

Contact us
Catalog number: C217
Price: 265 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Cytochrome b5, CYB5A (N-6His)
Quantity: 0.06 ml
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cytochrome b5A is produced by our E, coli expression system and the target gene encoding Met1-Asp134 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 5 kD
UniProt number: P00167
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 0, 150 mM sodium chloride, pH 7, 1 mM EDTA, 2 um filtered solution of 20 mM PB, 25, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CYB5A (N-6His), Cytochrome b5
Short name: CYB5A (N-6His), Recombinant Cytochrome b5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CYB5A (N-6His), sapiens Cytochrome b5, recombinant H
Alternative technique: rec
Identity: 2570
Gene: CYB5A | More about : CYB5A
Long gene name: cytochrome b5 type A
Synonyms gene: CYB5
Synonyms gene name: cytochrome b-5 cytochrome b5 (microsomal) cytochrome b5 type A (microsomal)
Locus: 18q22, 3
Discovery year: 1990-06-22
GenBank acession: M22865
Entrez gene record: 1528
Pubmed identfication: 1840560
RefSeq identity: NM_001914 NM_148923
Havana BLAST/BLAT: OTTHUMG00000132843

Related Products :

C217 Recombinant Human Cytochrome b5, CYB5A (N-6His) 50 µg 496 € novo human
GENTAUR-58bde7849c53c Mouse Monoclonal [clone 1A8] (IgG1,k) to Human CYB5A / Cytochrome b5 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde745dbdbd Mouse Monoclonal [clone 4C2] (IgG1,k) to Human CYB5A / Cytochrome b5 Antibody 50ug 663 € MBS mono human
GENTAUR-58b858ae6a29b Alouatta seniculus Cytochrome b5 (CYB5A) 100ug 1332 € MBS Recombinant Proteins human
GENTAUR-58b858aec9be5 Alouatta seniculus Cytochrome b5 (CYB5A) 1000ug 1332 € MBS Recombinant Proteins human
GENTAUR-58b858af36cfb Alouatta seniculus Cytochrome b5 (CYB5A) 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b858af96ff9 Alouatta seniculus Cytochrome b5 (CYB5A) 1000ug 1835 € MBS Recombinant Proteins human
AE48212HO-48 ELISA test for Horse Cytochrome b5 (CYB5A) 1x plate of 48 wells 402 € abebio horse
AE48209PI-48 ELISA test for Pig Cytochrome b5 (CYB5A) 1x plate of 48 wells 402 € abebio pig
AE48208RB-48 ELISA test for Rabbit Cytochrome b5 (CYB5A) 1x plate of 48 wells 402 € abebio human
AE48212HO-96 Horse Cytochrome b5 (CYB5A) ELISA Kit 1x plate of 96 wells 671 € abebio horse
AE48209PI-96 Pig Cytochrome b5 (CYB5A) ELISA Kit 1x plate of 96 wells 671 € abebio pig
AE48208RB Rabbit Cytochrome b5 (CYB5A) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE48208RB-96 Rabbit Cytochrome b5 (CYB5A) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58b891a72faec Rat Cytochrome b5 (Cyb5a) 1000ug 1398 € MBS Recombinant Proteins rat
GENTAUR-58b891a788738 Rat Cytochrome b5 (Cyb5a) 1000ug 1906 € MBS Recombinant Proteins rat
GWB-P0860B CYB5A, 1-108aa, Recombinant Protein bulk Ask price € genways bulk human
MBS624217 Cytochrome p450 2C9, ID (CYP2C9, (R)(S)-limonene 6-monooxygenase, (S)-limonene 6-monooxygenase, Cytochrome P450 PB-1, Cytochrome P450 MP-4, Cytochrome P450 MP-8, S-mephenytoin 4-hydroxylase) Antibody 200ul 603 € MBS Polyclonals_1 human
LV131183 CYB5A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV131184 CYB5A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV131185 CYB5A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV131186 CYB5A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV131188 CYB5A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV131187 CYB5A Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdfb45f13a2 Anti- CYB5A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfb464d92b Anti- CYB5A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdff27a98cb Anti- CYB5A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdff280a604 Anti- CYB5A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0865bedff Anti- CYB5A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be086608701 Anti- CYB5A Antibody 0.06 ml 265 € MBS Polyclonals human