Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His)

Contact us
Catalog number: C180
Price: 521 €
Supplier: genways
Product name: Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His)
Quantity: 1 vial
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Thymopoietin is produced by our E, coli expression system and the target gene encoding Pro2-Glu187 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 6 kD
UniProt number: P42167
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNELEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene: ERBIN | More about : ERBIN
Gene target: LAP2 (C-6His), TMPO, Thymopoietin
Short name: LAP2 (C-6His), TMPO, Recombinant Thymopoietin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: LAP2 (C-6His), TMPO, sapiens Thymopoietin, recombinant H
Alternative technique: rec
Identity: 15842
Long gene name: erbb2 interacting protein
Synonyms gene: ERBB2IP
Synonyms gene name: erbb2-interacting protein
Synonyms: LAP2
Synonyms name: densin-180-like protein ERBB2-interacting protein
Locus: 5q12, 3
Discovery year: 2001-06-18
Entrez gene record: 55914
Pubmed identfication: 10574462 10878805
RefSeq identity: NM_018695
Classification: PDZ domain containing
Havana BLAST/BLAT: OTTHUMG00000097808

Related Products :

C180 Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His) 50 µg 369 € novo human
MBS616705 LAP2, alpha (Lamina Associated Polypeptide 2 alpha, Thymopoietin, TMPO, TP) Antibody 0.05 ml 713 € MBS Polyclonals_1 human
MBS248731 Anti-Human TMPO / TP / Thymopoietin 50ug 597 € MBS Polyclonals_1 human
EKU07664 Thymopoietin (TMPO) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
AP54295PU-N anti-TMPO / LAP2 alpha (N-term) Antibody 0,4 ml 587 € acr human
AP55579CP-N anti-TMPO / LAP2 alpha (N-term) Control Peptide Antibody 50 Вµg 282 € acr human
101-M648 Anti-Human Thymopoietin 100ug 336 € Reliatech antibodies human
abx153290 Anti-Human Thymopoietin ELISA Kit inquire 50 € abbex human
abx142268 Anti-Thymopoietin Antibody 200 μl 514 € abbex human
GENTAUR-58bcf1dbe77fe Bovine Thymopoietin-1 100ug 1238 € MBS Recombinant Proteins bovine
GENTAUR-58bcf1dc3e301 Bovine Thymopoietin-1 1000ug 1238 € MBS Recombinant Proteins bovine
GENTAUR-58bcf1dc78928 Bovine Thymopoietin-1 100ug 1741 € MBS Recombinant Proteins bovine
GENTAUR-58bcf1dcbfdfc Bovine Thymopoietin-1 1000ug 1741 € MBS Recombinant Proteins bovine
MBS150125 Thymopoietin Antibody 100ug 431 € MBS Polyclonals_1 human
ZP-6605 Thymopoietin Peptide 0.05 mg 204 € Zyagen human
GENTAUR-58bd572b03c5b Human Lamina-associated polypeptide 2, isoforms beta/gamma (TMPO) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd572b4fdb1 Human Lamina-associated polypeptide 2, isoforms beta/gamma (TMPO) 1000ug 2078 € MBS Recombinant Proteins human
LV339522 TMPO Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdeafb0d95d Anti- TMPO Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeafb7a3ad Anti- TMPO Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3bd474100 Anti- TMPO Antibody 100ug 393 € MBS Polyclonals human
abx219056 Anti-TMPO Antibody 200 μg 369 € abbex human
abx900018 Anti-TMPO siRNA inquire 50 € abbex human
abx900039 Anti-TMPO siRNA inquire 50 € abbex human
abx937501 Anti-TMPO siRNA 30 nmol 717 € abbex human
abx937502 Anti-TMPO siRNA inquire 50 € abbex human
abx937503 Anti-TMPO siRNA inquire 50 € abbex human
GWB-MP944H TMPO antibody 1 vial 521 € genways human
GWB-MP945I TMPO antibody 1 vial 521 € genways human
GWB-MP946A TMPO antibody 1 vial 521 € genways human