Recombinant Human Small Ubiquitin-Related Modifier 1, SUMO1 (N-6His)

Contact us
Catalog number: C175
Price: 603 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Small Ubiquitin-Related Modifier 1, SUMO1 (N-6His)
Quantity: 200ul
Other quantities: 1 mg 334€ 50 µg 80€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SUMO1 is produced by our E, coli expression system and the target gene encoding Met1-Val101 is expressed with a 6His tag at the N-terminus
Molecular Weight: 13, 7 kD
UniProt number: P63165
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 100 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM TrisHCl, 5 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SUMO1 (N-6His), Ubiquitin-Related Modifier 1
Short name: SUMO1 (N-6His), Recombinant Ubiquitin- Modifier 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SUMO1 (N-6His), sapiens Small Ubiquitin-Related Modifier 1, recombinant H
Alternative technique: rec
Identity: 12502
Gene: SUMO1 | More about : SUMO1
Long gene name: small ubiquitin-like modifier 1
Synonyms gene: UBL1
Synonyms gene name: cerevisiae) , ubiquitin-like 1 (sentrin) SMT3 suppressor of mif two 3 homolog 1 (yeast) SMT3 suppressor of mif two 3 homolog 1 (S
Synonyms: PIC1 GMP1 SMT3C SUMO-1 SMT3H3 OFC10
Locus: 2q33, 1
Discovery year: 1996-06-04
GenBank acession: U38784
Entrez gene record: 7341
Pubmed identfication: 8812453 8906799
RefSeq identity: NM_003352
Havana BLAST/BLAT: OTTHUMG00000132839

Related Products :

C175 Recombinant Human Small Ubiquitin-Related Modifier 1, SUMO1 (N-6His) 50 µg 80 € novo human
MBS623878 SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Antibody 200ul 597 € MBS Polyclonals_1 human
MBS621083 Ubiquitin Related Modifier 1 (Ubiquitin-related Modifier 1 Homolog, URM1, URM-1, Chromosome 9 Open Reading Frame 74, C9orf74, MGC2668, RP11-339B21.4) Antibody 500ug 829 € MBS Polyclonals_1 human
GENTAUR-58b9ea967219a Arabidopsis thaliana Small ubiquitin-related modifier 1 (SUMO1) 100ug 1365 € MBS Recombinant Proteins human
GENTAUR-58b9ea96d7bac Arabidopsis thaliana Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1365 € MBS Recombinant Proteins human
GENTAUR-58b9ea973f4ae Arabidopsis thaliana Small ubiquitin-related modifier 1 (SUMO1) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b9ea9776614 Arabidopsis thaliana Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58baf8072baef Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 100ug 1365 € MBS Recombinant Proteins human
GENTAUR-58baf8077a785 Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1365 € MBS Recombinant Proteins human
GENTAUR-58baf807ca49a Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58baf80811ec0 Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58bb247178af5 Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 100ug 1365 € MBS Recombinant Proteins human
GENTAUR-58bb2471bf7f0 Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1365 € MBS Recombinant Proteins human
GENTAUR-58bb2472018f4 Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58bb24724fb86 Oryza sativa subsp. japonica Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b9dfd0c0fec Pig Small ubiquitin-related modifier 1 (SUMO1) 100ug 1359 € MBS Recombinant Proteins pig
GENTAUR-58b9dfd10c151 Pig Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1359 € MBS Recombinant Proteins pig
GENTAUR-58b9dfd16194d Pig Small ubiquitin-related modifier 1 (SUMO1) 100ug 1862 € MBS Recombinant Proteins pig
GENTAUR-58b9dfd1b5a83 Pig Small ubiquitin-related modifier 1 (SUMO1) 1000ug 1862 € MBS Recombinant Proteins pig
EKU07376 Small Ubiquitin Related Modifier Protein 1 (SUMO1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU08390 Small Ubiquitin Related Modifier Protein 1 (SUMO1) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
GENTAUR-58ba11cbd8ed4 Xenopus laevis Small ubiquitin-related modifier 1-A (sumo1-a) 100ug 1359 € MBS Recombinant Proteins xenopus
GENTAUR-58ba11cc45ad6 Xenopus laevis Small ubiquitin-related modifier 1-A (sumo1-a) 1000ug 1359 € MBS Recombinant Proteins xenopus
GENTAUR-58ba11ccadd97 Xenopus laevis Small ubiquitin-related modifier 1-A (sumo1-a) 100ug 1868 € MBS Recombinant Proteins xenopus
GENTAUR-58ba11cd2f1ef Xenopus laevis Small ubiquitin-related modifier 1-A (sumo1-a) 1000ug 1868 € MBS Recombinant Proteins xenopus
MBS623907 Ubiquitin-like Protein Modifier (Ubiquitin Like Protein Modifier, Homologous to Ubiquitin, Hub1, Hub1 Protein, HUB1 Target Protein 1, Hub1p) Antibody 500ug 829 € MBS Polyclonals_1 human
C176 Recombinant Human Small Ubiquitin-Related Modifier 2, SUMO2 (N-6His) 50 µg 80 € novo human
CM73 Recombinant Human Small Ubiquitin-Related Modifier 3, SUMO3, SMT3A (C-6His) 500 µg 1186 € novo human
CE04 Recombinant Human Small Ubiquitin-Related Modifier 3, SUMO3, SMT3A (N-6His) 1 mg 334 € novo human
MBS623666 SUMO4, mutant (V55) (Small Ubiquitin-related Modifier 4, Small Ubiquitin-like Protein 4, SUMO-4, SMT3H4) Antibody 200ul 603 € MBS Polyclonals_1 human