Recombinant Human Stathmin, STMN1 (C-6His)

Contact us
Catalog number: C174
Price: 558 €
Supplier: acr
Product name: Recombinant Human Stathmin, STMN1 (C-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Stathmin is produced by our E, coli expression system and the target gene encoding Ala2-Asp149 is expressed with a 6His tag at the C-terminus
Molecular Weight: 18, 37 kD
UniProt number: P16949
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: STMN1 (C-6His), Stathmin
Short name: STMN1 (C-6His), Recombinant Stathmin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: STMN1 (C-6His), sapiens Stathmin, recombinant H
Alternative technique: rec
Identity: 6510
Gene: STMN1 | More about : STMN1
Long gene name: stathmin 1
Synonyms gene: LAP18 C1orf215
Synonyms gene name: chromosome 1 open reading frame 215 stathmin 1/oncoprotein 18
Synonyms: SMN OP18 PR22 PP19 PP17 Lag FLJ32206
Synonyms name: oncoprotein 18
Locus: 1p36, 11
Discovery year: 1990-12-17
GenBank acession: J04991
Entrez gene record: 3925
Pubmed identfication: 2917975
RefSeq identity: NM_005563
Classification: Stathmins
Havana BLAST/BLAT: OTTHUMG00000007389

Related Products :

MBS621793 Stathmin 1, NT (Stathmin-1, STMN1, Stathmin, SMN, Lag, Leukemia-associated Phosphoprotein p18, LAP18, Metablastin, Oncoprotein 18, OP18, p18, p19, Phosphoprotein 19, Phosphoprotein p19, PP17, PP19, PR22, Pr22 Protein, Prosolin, Protein Pr22) Antibody 100ul 658 € MBS Polyclonals_1 human
MBS623195 Stathmin 1 (Stathmin-1, STMN1, Stathmin, SMN, Lag, Leukemia-associated Phosphoprotein p18, LAP18, Metablastin, Oncoprotein 18, OP18, p18, p19, Phosphoprotein 19, Phosphoprotein p19, PP17, PP19, PR22, Pr22 Protein, Prosolin, Protein Pr22) Antibody 100ug 735 € MBS Polyclonals_1 human
C174 Recombinant Human Stathmin, STMN1 (C-6His) 50 µg 369 € novo human
abx570575 Anti-Human Stathmin 1 (STMN1) ELISA Kit inquire 50 € abbex human
MBS242882 Anti-Human STMN1 / Stathmin / LAG Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS247865 Goat Polyclonal to Human STMN1 / Stathmin / LAG Antibody 50ug 597 € MBS Polyclonals_1 human
DL-STMN1-Hu Human Stathmin 1 STMN1 ELISA Kit 96T 904 € DL elisas human
MBS241396 PAb (IgG) to Human STMN1 / Stathmin / LAG 50ug 597 € MBS Polyclonals_1 human
MBS241754 PAb (IgG) to Human STMN1 / Stathmin / LAG 0.05 ml 597 € MBS Polyclonals_1 human
GWB-F2EF83 Stathmin 1/oncoprotein 18 (STMN1) Rabbit antibody to or anti-Human Polyclonal (pSer16) antibody 1 vial 602 € genways human
GWB-DAD4DA Stathmin 1/oncoprotein 18 (STMN1) Rabbit antibody to or anti-Human Polyclonal (Ser37) antibody 1 vial 602 € genways human
AR09158PU-L anti-Stathmin / STMN1 (1-149, His-tag) Antibody 0,5 mg 1138 € acr human
AR09158PU-N anti-Stathmin / STMN1 (1-149, His-tag) Antibody 0,1 mg 485 € acr human
AM11194PU-M anti-Stathmin / STMN1 Antibody 0,5 ml 804 € acr human
AM11194PU-N anti-Stathmin / STMN1 Antibody 1 ml 1138 € acr human
AM11194PU-S anti-Stathmin / STMN1 Antibody 0,1 ml 471 € acr human
AP02726PU-N anti-Stathmin / STMN1 Antibody 0,1 ml 442 € acr human
AP02726PU-S anti-Stathmin / STMN1 Antibody 50 Вµl 384 € acr human
AP02727PU-N anti-Stathmin / STMN1 Antibody 0,1 ml 442 € acr human
AP02727PU-S anti-Stathmin / STMN1 Antibody 50 Вµl 384 € acr human
AP02736PU-N anti-Stathmin / STMN1 Antibody 0,1 ml 442 € acr human
AP02736PU-S anti-Stathmin / STMN1 Antibody 50 Вµl 384 € acr human
AP08091PU-N anti-Stathmin / STMN1 Antibody 0,1 ml 442 € acr human
AP08091PU-S anti-Stathmin / STMN1 Antibody 50 Вµl 384 € acr human
AP15800PU-M anti-Stathmin / STMN1 Antibody 0,5 ml 572 € acr human
AP15800PU-N anti-Stathmin / STMN1 Antibody 1 ml 804 € acr human
AP15800PU-S anti-Stathmin / STMN1 Antibody 0,1 ml 326 € acr human
AP20715PU-N anti-Stathmin / STMN1 Antibody 0,1 mg 558 € acr human
AP20716PU-N anti-Stathmin / STMN1 Antibody 0,1 mg 558 € acr human
AP20717PU-N anti-Stathmin / STMN1 Antibody 0,1 mg 558 € acr human