Recombinant Human Sentrin-Specific Protease 8, SENP8 (N-6His)

Contact us
Catalog number: C172
Price: 785 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Sentrin-Specific Protease 8, SENP8 (N-6His)
Quantity: 100ul
Other quantities: 1 mg 405€ 10 µg 80€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Sentrin-Specific Protease 8 is produced by our E, coli expression system and the target gene encoding Met1-Lys212 is expressed with a 6His tag at the N-terminus
Molecular Weight: 24 kD, 26
UniProt number: Q96LD8
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SENP8 (N-6His), Sentrin-Specific Protease 8
Short name: SENP8 (N-6His), Recombinant Sentrin-Specific Protease 8
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SENP8 (N-6His), sapiens Sentrin-Specific Protease 8, recombinant H
Alternative technique: rec
Identity: 22992
Gene: SENP8 | More about : SENP8
Long gene name: NEDD8 specific , SUMO/sentrin peptidase family member
Synonyms gene: PRSC2
Synonyms gene name: 2 (NEDD8 specific) SUMO/sentrin specific protease family member 8 SUMO/sentrin specific peptidase family member 8 , cysteine, protease
Synonyms: NEDP1 DEN1 HsT17512
Synonyms name: NEDD8-specific protease 1 sentrin/SUMO-specific protease SENP8 deneddylase 1
Locus: 15q23
Discovery year: 2003-09-02
GenBank acession: BC031411
Entrez gene record: 123228
Pubmed identfication: 12730221 12759362
RefSeq identity: NM_145204
Classification: SUMO specific peptidases
Havana BLAST/BLAT: OTTHUMG00000133441

Related Products :

MBS624565 SENP3, NT (Sentrin-specific Protease 3, Sentrin/SUMO-specific Protease SENP3, SUMO-1 Specific Protease 3, SSP3, SUSP3) 200ul 603 € MBS Polyclonals_1 human
MBS623950 SENP6, NT (SUSP1, Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, SUMO-1-specific Protease 1, KIAA0797, SSP1, FKSG6) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS623942 SENP7, CT (Sentrin-specific Protease 7, Sentrin/SUMO-specific Protease SENP7, SUMO-1-specific Protease 2, SENP7, KIAA1707, SSP2, SUSP2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624528 SENP2, CT (Sentrin-specific Protease 2, Sentrin/SUMO-specific Protease SENP2, SMT3-Specific Isopeptidase 2, Smt3ip2, Axam2, KIAA1331) 200ul 603 € MBS Polyclonals_1 human
C172 Recombinant Human Sentrin-Specific Protease 8, SENP8 (N-6His) 1 mg 405 € novo human
MBS624237 SENP1, NT (Sentrin-specific Protease 1, Sentrin/SUMO-specific Protease SENP1, SEN1) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58bd67fdd7fe7 Rat Sentrin-specific protease 8 (Senp8) 100ug 1658 € MBS Recombinant Proteins rat
GENTAUR-58bd67fe2fab5 Rat Sentrin-specific protease 8 (Senp8) 1000ug 1658 € MBS Recombinant Proteins rat
GENTAUR-58bd67fe67a87 Rat Sentrin-specific protease 8 (Senp8) 100ug 2172 € MBS Recombinant Proteins rat
GENTAUR-58bd67fec77f2 Rat Sentrin-specific protease 8 (Senp8) 1000ug 2172 € MBS Recombinant Proteins rat
CH01 Recombinant Human Sentrin-Specific Protease 2, SENP2 (N-6His, SUMO tag) 1 mg 1014 € novo human
C171 Recombinant Human Sentrin-Specific Protease 7, SENP7 (N-6His) 1 mg 2283 € novo human
MBS623159 USP18 (Ubiquitin Specific Protease 18, Ubiquitin-specific Protease 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Carboxyl-terminal Hydrolase 18, Ubl Thioesterase 18) 100ug 829 € MBS Polyclonals_1 human
GENTAUR-58bda63d5ec61 Human Sentrin-specific protease 5 (SENP5) 100ug 3039 € MBS Recombinant Proteins human
GENTAUR-58bda63dbe424 Human Sentrin-specific protease 5 (SENP5) 1000ug 3039 € MBS Recombinant Proteins human
GENTAUR-58bda63e33e9e Human Sentrin-specific protease 5 (SENP5) 100ug 3503 € MBS Recombinant Proteins human
GENTAUR-58bda63e8f8f4 Human Sentrin-specific protease 5 (SENP5) 1000ug 3503 € MBS Recombinant Proteins human
MBS612189 SENP1 (Sentrin, SUMO-specific protease 1) 50ug 597 € MBS Polyclonals_1 human
MBS611921 SENP1 (Sentrin, SUMO-specific protease 1) Antibody 200ul 492 € MBS Polyclonals_1 human
MBS610713 SENP2 (Sentrin SUMO-specific protease 2) Antibody 200ul 525 € MBS Polyclonals_1 human
MBS618883 SENP3, NT (Sentrin SUMO-specific protease 3) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS610262 SENP5 (Sentrin SUMO-specific protease 5) Antibody 200ul 525 € MBS Polyclonals_1 human
MBS615248 SENP6 (Sentrin SUMO-specific protease 6) 100ug 763 € MBS Polyclonals_1 human
MBS619838 SENP6 (SUSP1, SUMO1/sentrin specific peptidase 6, RP1-134M13.1, FLJ11355, FLJ11887, KIAA0389, KIAA0797, SSP1, SUSP1, 2810017C20Rik) Antibody 100ug 591 € MBS Polyclonals_1 human
RP-968 Recombinant (E.Coli) Human Small Ubiquitin-Related Modifier 2 (Sentrin-2) 2 μg 405 € adi human
GWB-P0926C SENP8, 1-212aa, Recombinant Protein bulk Ask price € genways bulk human
MBS621243 USP11 (Ubiquitin Specific Peptidase 11, Ubiquitin Specific Protease 11, Ubiquitin Specific-processing Protease 11, Deubiquitinating Enzyme 11, Ubiquitin Carboxyl-terminal Hydrolase X-linked, Ubiquitin Thiolesterase 11, UHX1) 100ug 735 € MBS Polyclonals_1 human
MBS620746 USP15 (Ubiquitin Specific Peptidase 15, Ubiquitin Specific-processing Protease 15, Ubiquitin Specific Protease 15, Deubiquitinating Enzyme 15, Deubiquitinating Enzyme, KIAA0529, MGC131982, MGC149838, MGC74854, Ubiquitin Carboxy Terminal Hydrolase 15, Ubiq 100ug 785 € MBS Polyclonals_1 human
MBS619808 USP24 (Ubiquitin Specific Peptidase 24, Ubiquitin Specific Protease 24, Ubiquitin Specific-processing Protease 24, Deubiquitinating Enzyme 24, KIAA1057, Ubiquitin Carboxyl Terminal Hydrolase 24, Ubiquitin Thioesterase 24) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS620278 USP28 (Ubiquitin Specific Peptidase 28, Ubiquitin Specific Protease 28, Ubiquitin Specific-processing Protease 28, USP28 Protein, Deubiquitinating Enzyme 28, KIAA1515, Ubiquitin Carboxyl Terminal Hydrolase 28, Ubiquitin Thioesterase 28) Antibody 100ul 785 € MBS Polyclonals_1 human