Recombinant Human Retinol-Binding Protein 4, RBP4

Contact us
Catalog number: C169
Price: 402 €
Supplier: abebio
Product name: Recombinant Human Retinol-Binding Protein 4, RBP4
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Retinol-Binding Protein 4 is produced by our E, coli expression system and the target gene encoding Glu19-Leu201 is expressed
Molecular Weight: 2 kD, 21
UniProt number: P02753
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 10 mM CaCl2, 150 mM sodium chloride, pH 7, 2 um filtered solution of 50 mM TrisHCl, 5 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RBP4, Retinol-Binding Protein 4
Short name: RBP4, Recombinant Retinol-Binding Protein 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: plasma, retinol binding protein 4, sapiens Retinol-Binding Protein 4, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, RBP4 and IDBG-637726 and ENSBTAG00000000442 and 281444, RBP4 and IDBG-82806 and ENSG00000138207 and 5950, RDCCAS, Rbp4 and IDBG-162693 and ENSMUSG00000024990 and 19662, plasma, protein heterodimerization activity, this GO :0001523 and retinoid metabolic process and biological process this GO :0001654 and eye development and biological process this GO :0005215 and transporter activity and molecular function this GO :0005501 and retinoid binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006094 and gluconeogenesis and biological process this GO :0006810 and transport and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007507 and heart development and biological process this GO :0007603 and phototransduction, this GO :0005215 : transporter activity, this GO :0005215 : transporter activity and also this GO :0005501 : retinoid binding and also this GO :0005515 : protein binding and also this GO :0016918 : retinal binding and also this GO :0019841 : retinol binding and also this GO :0034632 : retinol transporter activity and also this GO :0036094 : small molecule binding and also this GO :0046982 : protein heterodimerization activity, this GO :0005501 : retinoid binding, this GO :0005515 : protein binding, this GO :0016918 : retinal binding, this GO :0019841 : retinol binding, this GO :0034632 : retinol transporter activity, this GO :0036094 : small molecule binding, this GO :0046982 : protein heterodimerization activity, visible light and biological process this GO :0008584 and male this GO nad development and biological process this GO :0016918 and retinal binding and molecular function this GO :0019841 and retinol binding and molecular function this GO :0030277 and maintenance of gastrointestinal epithelium and biological process this GO :0030324 and lung development and biological process this GO :0032024 and positive regulation of insulin secretion and biological process this GO :0032526 and response to retinoic acid and biological process this GO :0032868 and response to insulin and biological process this GO :0034632 and retinol transporter activity and molecular function this GO :0034633 and retinol transport and biological process this GO :0036094 and small molecule binding and molecular function this GO :0042572 and retinol metabolic process and biological process this GO :0042574 and retinal metabolic process and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0043234 and protein complex and cellular component this GO :0045471 and response to ethanol and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048562 and embryonic organ morphogenesis and biological process this GO :0048706 and embryonic skeletal system development and biological process this GO :0048738 and cardiac muscle tissue development and biological process this GO :0048807 and female genitalia morphogenesis and biological process this GO :0050908 and detection of light stimulus involved in visual perception and biological process this GO :0051024 and positive regulation of immunoglobulin secretion and biological process this GO :0060041 and retina development in camera-type eye and biological process this GO :0060044 and negative regulation of cardiac muscle cell proliferation and biological process this GO :0060059 and embryonic retina morphogenesis in camera-type eye and biological process this GO :0060065 and uterus development and biological process this GO :0060068 and vagina development and biological process this GO :0060157 and urinary bladder development and biological process this GO :0060347 and heart trabecula formation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, retinol binding protein 4
Identity: 9922
Gene: RBP4 | More about : RBP4
Long gene name: retinol binding protein 4
Synonyms gene name: plasma , retinol-binding protein 4
Locus: 10q23, 33
Discovery year: 2001-06-22
GenBank acession: BC020633
Entrez gene record: 5950
RefSeq identity: NM_006744
Classification: Lipocalins
Havana BLAST/BLAT: OTTHUMG00000018773

Related Products :

C169 Recombinant Human Retinol-Binding Protein 4, RBP4 500 µg 1613 € novo human
AE22652HU-48 ELISA test for Human Retinol binding protein 4 (RBP4) 1x plate of 48 wells 402 € abebio human
DL-RBP4-Hu Human Retinol Binding Protein 4, Plasma RBP4 ELISA Kit 96T 672 € DL elisas human
AE22652HU Human Retinol binding protein 4 (RBP4) ELISA Kit 96 wells plate 840 € ab-elisa elisas human
AE22652HU-96 Human Retinol binding protein 4 (RBP4) ELISA Kit 1x plate of 96 wells 671 € abebio human
RBP41-M Monoclonal Anti-Human Retinol binding protein 4 (RBP4) 100 μg 565 € adi human
AP50037HU Human Retinol Binding 4, Plasma (RBP4) 5ug 352 € AbELISA Rec human
AP50111HU Human Retinol binding 4 (RBP4 ) 0.1mg 259 € AbELISA Rec human
GENTAUR-58bdc12cd1ef4 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc26b3d9e9 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc26b9bdde Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc3be569df Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc8e92cffa Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 50ug 299 € MBS Polyclonals human
GENTAUR-58bdc8e9c4384 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdc9758bb0d Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 50ug 299 € MBS Polyclonals human
GENTAUR-58bdc977673d5 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdc9d247eab Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 382 € MBS Polyclonals human
GENTAUR-58bdcd238f9e7 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 382 € MBS Polyclonals human
GENTAUR-58bdce3eb2f48 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdce3f1fed1 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdce5a62c14 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdce5acd193 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcfb982b4e Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd807d7627 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 404 € MBS Polyclonals human
GENTAUR-58bdd8f580cd0 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 597 € MBS Polyclonals human
GENTAUR-58bddb94b7899 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddc2ed3879 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 404 € MBS Polyclonals human
GENTAUR-58bddd70f29c4 Anti- Retinol Binding Protein 4, Plasma (RBP4) Antibody 100ug 597 € MBS Polyclonals human
DL-RBP4-b Bovine Retinol Binding Protein 4, Plasma RBP4 ELISA Kit 96T 962 € DL elisas bovine
AE22653HO-48 ELISA test for Horse Retinol-binding protein 4 (RBP4) 1x plate of 48 wells 402 € abebio horse