Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST)

Contact us
Catalog number: C149
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST)
Quantity: 0.12 ml
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LACTB2 is produced by our E, coli expression system and the target gene encoding Met1-Leu288 is expressed with a GST tag at the N-terminus
Molecular Weight: 24 kD, 59
UniProt number: Q53H82
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM EDTA, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LACTB2 (N-GST), &beta, -Lactamase-Like Protein 2
Short name: LACTB2 (N-GST), -Lactamase-Like Protein 2, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: LACTB2 (N-GST), sapiens &beta, -Lactamase-Like Protein 2, recombinant H
Alternative technique: rec
Identity: 18512
Gene: LACTB2 | More about : LACTB2
Long gene name: lactamase beta 2
Synonyms: CGI-83
Locus: 8q13, 3
Discovery year: 2004-02-09
GenBank acession: AF151841
Entrez gene record: 51110
RefSeq identity: NM_016027
Havana BLAST/BLAT: OTTHUMG00000164430

Related Products :

MBS611392 Penicillinase, E. clocae (Aer1, Aer-1, Beta-lactamase 1, Beta Lactamase AER1, Beta-lactamase AER-1, Beta-lactamase Type I, Bla, BlaL, Oxacillinase, OXA9, OXA-9, PenPC) (HRP) Antibody 2 miligrams 614 € MBS Polyclonals_1 human
C149 Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST) 500 µg 1613 € novo human
GSTA35-R-100 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 100 μg 985 € adi human
GSTA35-R-25 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 25 μg 405 € adi human
GSTA15-R-100 Recombinant purified human GST-alpha (GST-A1) protein biologically active 100 μg 985 € adi human
GSTA15-R-25 Recombinant purified human GST-alpha (GST-A1) protein biologically active 25 μg 405 € adi human
GSTA12-C Recombinant purified human GST-alpha (GST-A1) protein WB +ve control 100 μL 333 € adi human
GSTM25-R-100 Recombinant purified human GST-mu (GST-M1) protein biologically active 100 μg 985 € adi human
GSTM25-R-25 Recombinant purified human GST-mu (GST-M1) protein biologically active 25 μg 405 € adi human
GSTM12-C Recombinant purified human GST-mu (GST-M1) protein WB +ve control 100 μL 333 € adi human
GSTM35-R-25 Recombinant purified human GST-mu (GST-M2) protein 25 μg 405 € adi human
GSTP35-R-100 Recombinant purified human GST-pi (GST-P1) protein biologically active 100 μg 985 € adi human
GSTP35-R-25 Recombinant purified human GST-pi (GST-P1) protein biologically active 25 μg 405 € adi human
GSTP12-C Recombinant purified human GST-pi (GST-P1) protein WB +ve control 100 μL 333 € adi human
GSTT45-R-100 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 100 μg 985 € adi human
GSTT45-R-25 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 25 μg 405 € adi human
PTEN15-R-10 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 10 μg 478 € adi human
PTEN15-R-50 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 50 μg 1058 € adi human
PTEN11-C Recombinant purified Human PTEN-GST fusion Protein (full length, GST-tag) control for WB 100 μL 333 € adi human
MBS618313 Resistin-like Molecule, beta (RELMbeta, RELMb, Resistin-like beta, Resistin-like Protein beta, Resistin Like Protein beta, RETNLB, C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein Precursor 2, Colon and Small Intestine-specific Cyst Antibody 100ug 597 € MBS Polyclonals_1 human
MBS610792 TBL1 (TBL1X, EBI, TBL1, transducin (beta)-like 1X-linked, transducin (beta)-like 1, transducin (beta)-like 1 X-linked, TBL1XR1, transducin (beta)-like 1X-linked receptor 1, C21, DC42, FLJ12894, IRA1, TBLR1, TBL1-related protein 1, nuclear receptor co-repr Antibody 100ug 591 € MBS Polyclonals_1 human
LV202776 LACTB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV202777 LACTB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV202778 LACTB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV202779 LACTB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV202781 LACTB2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV202780 LACTB2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bdfdafc1164 Anti- LACTB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfdb02021c Anti- LACTB2 Antibody 0.12 ml 348 € MBS Polyclonals human