Recombinant Human Fatty Acid-Binding Protein 5, FABP5, E-FABP (N-6His)

Contact us
Catalog number: C137
Price: 402 €
Supplier: abebio
Product name: Recombinant Human Fatty Acid-Binding Protein 5, FABP5, E-FABP (N-6His)
Quantity: 1x plate of 48 wells
Other quantities: 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FABP5 is produced by our E, coli expression system and the target gene encoding Ala2-Glu135 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 33 kD
UniProt number: Q01469
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: E-FABP (N-6His), FABP5, Fatty Acid-Binding Protein 5
Short name: E-FABP (N-6His), FABP5, Recombinant Fatty Acid-Binding Protein 5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: E-FABP (N-6His), FABP5, sapiens Fatty Acid-Binding Protein 5, recombinant H
Alternative technique: rec
Identity: 3560
Gene: FABP5 | More about : FABP5
Long gene name: fatty acid binding protein 5
Synonyms gene name: fatty acid binding protein 5 (psoriasis-associated)
Synonyms: E-FABP PA-FABP KFABP
Locus: 8q21, 13
Discovery year: 1995-03-28
GenBank acession: M94856
Entrez gene record: 2171
Pubmed identfication: 1512466
RefSeq identity: NM_001444
Classification: Fatty acid binding protein family
Havana BLAST/BLAT: OTTHUMG00000134313

Related Products :

MBS624553 FABP4, phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623619 Fatty Acid Binding Protein, Liver (Liver-type Fatty Acid-binding Protein, L-FABP, Fatty Acid-binding Protein 1, FABP1, Fabplg, MGC108756, p14, RATFABPLG, Squalene- and Sterol-carrier Protein, SCP, Z-protein) Antibody 100ug 1078 € MBS Polyclonals_1 human
C137 Recombinant Human Fatty Acid-Binding Protein 5, FABP5, E-FABP (N-6His) 500 µg 1613 € novo human
GWB-D3A014 Fatty Acid Binding protein (FABP) > 95% purified - Purified native Human FABP protein 1 vial 891 € genways human
C133 Recombinant Human Fatty Acid-Binding Protein 1, FABP1, L-FABP (N-6His) 500 µg 1613 € novo human
C134 Recombinant Human Fatty Acid-Binding Protein 2, FABP2, I-FABP ((N, C-6His) 500 µg 1186 € novo human
C135 Recombinant Human Fatty Acid-Binding Protein 3, FABP3, H-FABP (N-6His) 10 µg 156 € novo human
C136 Recombinant Human Fatty Acid-Binding Protein 4, FABP4, A-FABP, aP2 (N-6His) 500 µg 1613 € novo human
C138 Recombinant Human Fatty Acid-Binding Protein 7, FABP7, B-FABP (N-6His) 500 µg 1613 € novo human
RP-0667H Recombinant Human FABP5 / E-FABP Protein 50μg 624 € adv human
DL-FABP5-Hu Human Fatty Acid Binding Protein 5, Epidermal FABP5 ELISA Kit 96T 869 € DL elisas human
RP-1677H Recombinant Human FABP3 / H-FABP / M-FABP Protein 50μg 624 € adv human
MBS620851 Fatty Acid Binding Protein 9, testis (FABP9, PERF, PERF15, Testis lipid-binding protein, T-FABP, TLBP) Antibody 100ug 774 € MBS Polyclonals_1 human
GENTAUR-58bdc2176d876 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc217db381 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc21ecc7ac Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdc36c309c2 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4dc826ba Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcaa8c729c Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcaa933a93 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdce4671031 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdce46f2cbf Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd57d52240 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd5bce6915 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd5f9210d9 Anti- Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody 100ug 575 € MBS Polyclonals human
MBS619811 Epidermal Fatty Acid Binding Protein (EFABP, FABP5) 100ug 575 € MBS Polyclonals_1 human
EKU04041 Fatty Acid Binding Protein 5, Epidermal (FABP5) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU04042 Fatty Acid Binding Protein 5, Epidermal (FABP5) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
DL-FABP5-Mu Mouse Fatty Acid Binding Protein 5, Epidermal FABP5 ELISA Kit 96T 904 € DL elisas mouse
AE44870HU-48 ELISA test for Human Fatty acid binding protein 4 (FABP-4) 1x plate of 48 wells 402 € abebio human