Recombinant Human Fatty Acid-Binding Protein 3, FABP3, H-FABP (N-6His)

Contact us
Catalog number: C135
Price: 930 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Fatty Acid-Binding Protein 3, FABP3, H-FABP (N-6His)
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FABP3 is produced by our E, coli expression system and the target gene encoding Val2-Ala133 is expressed with a 6His tag at the N-terminus
Molecular Weight: 02 kD, 17
UniProt number: P05413
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 6, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FABP3, H-FABP (N-6His), Fatty Acid-Binding Protein 3
Short name: FABP3, H-FABP (N-6His), Recombinant Fatty Acid-Binding Protein 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: FABP3, H-FABP (N-6His), sapiens Fatty Acid-Binding Protein 3, recombinant H
Alternative technique: rec
Identity: 3557
Gene: FABP3 | More about : FABP3
Long gene name: fatty acid binding protein 3
Synonyms gene: MDGI FABP11
Synonyms gene name: fatty acid binding protein 11 fatty acid binding protein 3, muscle and heart , muscle and heart (mammary-derived growth inhibitor) fatty acid binding protein 3
Synonyms: H-FABP O-FABP
Synonyms name: mammary-derived growth inhibitor
Locus: 1p35, 2
Discovery year: 1991-08-06
GenBank acession: U57623
Entrez gene record: 2170
Pubmed identfication: 8661024
RefSeq identity: NM_004102
Classification: Fatty acid binding protein family
Havana BLAST/BLAT: OTTHUMG00000003797

Related Products :

MBS624553 FABP4, phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623619 Fatty Acid Binding Protein, Liver (Liver-type Fatty Acid-binding Protein, L-FABP, Fatty Acid-binding Protein 1, FABP1, Fabplg, MGC108756, p14, RATFABPLG, Squalene- and Sterol-carrier Protein, SCP, Z-protein) Antibody 100ug 1078 € MBS Polyclonals_1 human
C135 Recombinant Human Fatty Acid-Binding Protein 3, FABP3, H-FABP (N-6His) 10 µg 156 € novo human
RP-1677H Recombinant Human FABP3 / H-FABP / M-FABP Protein 50μg 624 € adv human
GWB-D3A014 Fatty Acid Binding protein (FABP) > 95% purified - Purified native Human FABP protein 1 vial 891 € genways human
C133 Recombinant Human Fatty Acid-Binding Protein 1, FABP1, L-FABP (N-6His) 500 µg 1613 € novo human
C134 Recombinant Human Fatty Acid-Binding Protein 2, FABP2, I-FABP ((N, C-6His) 500 µg 1186 € novo human
C136 Recombinant Human Fatty Acid-Binding Protein 4, FABP4, A-FABP, aP2 (N-6His) 500 µg 1613 € novo human
C137 Recombinant Human Fatty Acid-Binding Protein 5, FABP5, E-FABP (N-6His) 500 µg 1613 € novo human
C138 Recombinant Human Fatty Acid-Binding Protein 7, FABP7, B-FABP (N-6His) 500 µg 1613 € novo human
MBS620851 Fatty Acid Binding Protein 9, testis (FABP9, PERF, PERF15, Testis lipid-binding protein, T-FABP, TLBP) Antibody 100ug 774 € MBS Polyclonals_1 human
DL-FABP3-Hu Human Fatty Acid Binding Protein 3, Muscle And Heart FABP3 ELISA Kit 96T 869 € DL elisas human
AP50001HU Human Fatty Acid Binding 3, Muscle And Heart (FABP3) 0.1mg 1085 € AbELISA Rec human
GENTAUR-58bdc156d9800 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc22bc5b5f Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc22c08949 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc38a99224 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdc48cc2b1f Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc88850eb2 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc888b5896 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcbd273434 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcbd2e7ddd Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd44203e50 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 580 € MBS Polyclonals human
GENTAUR-58bdd669351c9 Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd9e976c8d Anti- Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) Antibody 100ug 553 € MBS Polyclonals human
E-EL-Ch0702 Chicken FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart) ELISA Kit 96T 568 € elabsciences chicken
AE44872PI-48 ELISA test for Pig Fatty acid-binding protein, heart (FABP3) 1x plate of 48 wells 402 € abebio pig
EKU04034 Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU04035 Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU04036 Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human