Recombinant Human β-Defensin 4, DEFB4

Contact us
Catalog number: C126
Price: 7155 €
Supplier: adi
Product name: Recombinant Human β-Defensin 4, DEFB4
Quantity: 1000 μg
Other quantities: 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human beta-Defensin 4 is produced by our E, coli expression system and the target gene encoding Glu23-Pro72 is expressed
Molecular Weight: 5, 99 kD
UniProt number: Q8WTQ1
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 130 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DEFB4, &beta, -Defensin 4
Short name: DEFB4, -Defensin 4, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: DEFB4, sapiens &beta, -Defensin 4, recombinant H
Alternative technique: rec
Identity: 18115
Gene: DEFB104A | More about : DEFB104A
Long gene name: defensin beta 104A
Synonyms gene: DEFB104
Synonyms gene name: beta 104 defensin, beta 104A , defensin
Synonyms: DEFB4 DEFB-4
Locus: 8p23, 1
Discovery year: 2002-05-09
GenBank acession: AJ314835
Entrez gene record: 140596
RefSeq identity: NM_080389
Classification: Defensins, beta
Havana BLAST/BLAT: OTTHUMG00000150014

Related Products :

C126 Recombinant Human β-Defensin 4, DEFB4 10 µg 156 € novo human
GENTAUR-58ba98d04664f Mouse Beta-defensin 4 (Defb4) 100ug 1216 € MBS Recombinant Proteins mouse
GENTAUR-58ba98d0df8b5 Mouse Beta-defensin 4 (Defb4) 1000ug 1216 € MBS Recombinant Proteins mouse
GENTAUR-58ba98d189ba6 Mouse Beta-defensin 4 (Defb4) 100ug 1719 € MBS Recombinant Proteins mouse
GENTAUR-58ba98d205338 Mouse Beta-defensin 4 (Defb4) 1000ug 1719 € MBS Recombinant Proteins mouse
GENTAUR-58ba994024e26 Mouse Beta-defensin 4 (Defb4) 100ug 1216 € MBS Recombinant Proteins mouse
GENTAUR-58ba99408cf17 Mouse Beta-defensin 4 (Defb4) 1000ug 1216 € MBS Recombinant Proteins mouse
GENTAUR-58ba99418e479 Mouse Beta-defensin 4 (Defb4) 100ug 1719 € MBS Recombinant Proteins mouse
GENTAUR-58ba9941e438a Mouse Beta-defensin 4 (Defb4) 1000ug 1719 € MBS Recombinant Proteins mouse
GENTAUR-58b87032782d6 Rat Beta-defensin 4 (Defb4) 100ug 1216 € MBS Recombinant Proteins rat
GENTAUR-58b87032cefdc Rat Beta-defensin 4 (Defb4) 1000ug 1216 € MBS Recombinant Proteins rat
GENTAUR-58b8703332a69 Rat Beta-defensin 4 (Defb4) 100ug 1719 € MBS Recombinant Proteins rat
GENTAUR-58b87033643f5 Rat Beta-defensin 4 (Defb4) 1000ug 1719 € MBS Recombinant Proteins rat
GENTAUR-58be45ad595b9 Anti- DEFB4 Antibody 100ug 393 € MBS Polyclonals human
abx913958 Anti-DEFB4 siRNA inquire 50 € abbex human
abx913959 Anti-DEFB4 siRNA inquire 50 € abbex human
MBS129078 DEFB4 Antibody 50ug 304 € MBS Polyclonals_1 human
RP-0550H Recombinant Human Defensin / Beta-defensin 3 / DEFB103 Protein (His Tag) 50μg 624 € adv human
AP23709PU-N anti-Defensin alpha 1 (+Defensin alpha 3) Antibody 0,1 mg 558 € acr human
HBD17-R-10 Recombinant (E. coli), purified, Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa), biologically active 10 μg 449 € adi human
HBD17-R-100 Recombinant (E. coli), purified, Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa), biologically active 100 μg 2298 € adi human
HBD17-R-1000 Recombinant (E. coli), purified, Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa), biologically active 1000 μg 6575 € adi human
HBD25-R-10 Recombinant (E. coli), purified, Human beta-Defensin 2 (BD-2/hBD-2) full length peptide (41 aa), biologically active 10 μg 405 € adi human
HBD25-R-100 Recombinant (E. coli), purified, Human beta-Defensin 2 (BD-2/hBD-2) full length peptide (41 aa), biologically active 100 μg 2588 € adi human
HBD25-R-1000 Recombinant (E. coli), purified, Human beta-Defensin 2 (BD-2/hBD-2) full length peptide (41 aa), biologically active 1000 μg 7155 € adi human
HBD45-R-20 Recombinant (E. coli), purified, Human beta-Defensin 4 (BD-4/hBD-4) full length protein (50 aa), biologically active 20 μg 695 € adi human
HBD45-R-5 Recombinant (E. coli), purified, Human beta-Defensin 4 (BD-4/hBD-4) full length protein (50 aa), biologically active 5 μg 333 € adi human
HBD37-R-10 Recombinant (E.Coli), purified, Human beta-Defensin 3 (BD-3/hBD-3, full length peptide (45 aa), biologically active 10 μg 405 € adi human
HBD37-R-100 Recombinant (E.Coli), purified, Human beta-Defensin 3 (BD-3/hBD-3, full length peptide (45 aa), biologically active 100 μg 2588 € adi human
HBD37-R-1000 Recombinant (E.Coli), purified, Human beta-Defensin 3 (BD-3/hBD-3, full length peptide (45 aa), biologically active 1000 μg 7155 € adi human