Recombinant Human Cytoglobin, CYGB (C-6His)

Contact us
Catalog number: C124
Price: 587 €
Supplier: acr
Product name: Recombinant Human Cytoglobin, CYGB (C-6His)
Quantity: 50 Вµg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cytoglobin is produced by our E, coli expression system and the target gene encoding Met1-Pro190 is expressed with a 6His tag at the C-terminus
Molecular Weight: 22, 44 kD
UniProt number: Q8WWM9
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, pH 8, 0 , 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGPLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CYGB (C-6His), Cytoglobin
Short name: CYGB (C-6His), Recombinant Cytoglobin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CYGB (C-6His), sapiens Cytoglobin, recombinant H
Alternative technique: rec
Identity: 16505
Gene: CYGB | More about : CYGB
Long gene name: cytoglobin
Synonyms: HGB STAP
Synonyms name: stellate cell activation-associated protein histoglobin
Locus: 17q25, 1
Discovery year: 2001-09-21
GenBank acession: AJ315162
Entrez gene record: 114757
Pubmed identfication: 11919282
RefSeq identity: NM_134268
Havana BLAST/BLAT: OTTHUMG00000180289

Related Products :

C124 Recombinant Human Cytoglobin, CYGB (C-6His) 50 µg 369 € novo human
RP-0519H Recombinant Human Cytoglobin / CYGB Protein (His Tag) 20μg 572 € adv human
abx571357 Anti-Human Cytoglobin (CYGB) ELISA Kit 96 tests 789 € abbex human
DL-CYGB-Hu Human Cytoglobin CYGB ELISA Kit 96T 904 € DL elisas human
abx573570 Anti-Rat Cytoglobin (CYGB) ELISA Kit 96 tests 833 € abbex rat
EKU03614 Cytoglobin (CYGB) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU03615 Cytoglobin (CYGB) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-CYGB-Ra Rat Cytoglobin CYGB ELISA Kit 96T 962 € DL elisas rat
abx168146 Anti-Cytoglobin Protein (Recombinant) 50 μg 601 € abbex human
abx168526 Anti-Cytoglobin Protein (Recombinant) 10 μg 427 € abbex human
abx262892 Anti-Cytoglobin Protein (Recombinant) 1 mg 6662 € abbex human
GWB-P1446C CYGB, 1-190aa, Recombinant Protein bulk Ask price € genways bulk human
abx151248 Anti-Human Cytoglobin ELISA Kit inquire 50 € abbex human
GWB-BSP450 CYGB Human Protein bulk Ask price € genways bulk human
LV131627 CYGB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV131628 CYGB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV131629 CYGB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV131630 CYGB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV131632 CYGB Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV131631 CYGB Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be076ecc18d Anti- CYGB Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be076f419d5 Anti- CYGB Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be544244c84 Anti- CYGB Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be5442c956c Anti- CYGB Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be544344c16 Anti- CYGB Antibody 50ug 304 € MBS Polyclonals human
abx901371 Anti-CYGB siRNA 15 nmol 528 € abbex human
abx913332 Anti-CYGB siRNA inquire 50 € abbex human
abx913333 Anti-CYGB siRNA 15 nmol 528 € abbex human
AR09529PU-L anti-Cytoglobin (1-190, His-tag) Antibody 0,25 mg 1500 € acr human
AR09529PU-N anti-Cytoglobin (1-190, His-tag) Antibody 50 Вµg 587 € acr human