| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CRYAB is produced by our E, coli expression system and the target gene encoding Met1-Lys175 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
21, 22 kD |
| UniProt number: |
P02511 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKKLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
B Crystallin Chain, CRYAB (C-6His), &alpha |
| Short name: |
B Crystallin Chain, CRYAB (C-6His), Recombinant &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
B Crystallin epitope, alpha B (C-6His), crystallin, sapiens &alpha, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CMD1II and CRYA2 and CTPP2 and CTRCT16 and HEL-S-101 and HSPB5 and MFM2, CRYAB and IDBG-630321 and ENSBTAG00000000434 and 281719, CRYAB and IDBG-71081 and ENSG00000109846 and 1410, Cryab and IDBG-164070 and ENSMUSG00000032060 and 12955, alpha B, nuclei, this GO :0001666 and response to hypoxia and biological process this GO :0002088 and lens development in camera-type eye and biological process this GO :0005212 and structural constituent of eye lens and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006457 and protein folding and biological process this GO :0006936 and muscle contraction and biological process this GO :0007021 and tubulin complex assembly and biological process this GO :0007517 and muscle organ development and biological process this GO :0007568 and aging and biological process this GO :0008017 and microtubule binding and molecular function this GO :0008092 and cytoskeletal protein binding and molecular function this GO :0009986 and cell surface and cellular component this GO :0010629 and negative regulation of gene expression and biological process this GO :0010941 and regulation of cell death and biological process this GO :0015630 and microtubule cytoskeleton and cellular component this GO :0030018 and Z disc and cellular component this GO :0030308 and negative regulation of cell growth and biological process this GO :0031109 and microtubule polymerization or depolymerization and biological process this GO :0031674 and I band and cellular component this GO :0032355 and response to estradiol and biological process this GO :0032387 and negative regulation of intracellular transport and biological process this GO :0032432 and actin filament bundle and cellular component this GO :0042542 and response to hydrogen peroxide and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043010 and camera-type eye development and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043292 and contractile fiber and cellular component this GO :0046872 and metal ion binding and molecular function this GO :0051082 and unfolded protein binding and molecular function this GO :0051260 and protein homooli this GO merization and biological process this GO :0051403 and stress-activated MAPK cascade and biological process this GO :0060561 and apoptotic process involved in morphogenesis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071480 and cellular response to gamma radiation and biological process this GO :2000378 and negative regulation of reactive oxygen species metabolic process and biological process, this GO :0005212 : structural constituent of eye lens, this GO :0005212 : structural constituent of eye lens and also this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0008092 : cytoskeletal protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046872 : metal ion binding and also this GO :0051082 : unfolded protein binding, this GO :0005515 : protein binding, this GO :0008017 : microtubule binding, this GO :0008092 : cytoskeletal protein binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046872 : metal ion binding, this GO :0051082 : unfolded protein binding, unfolded protein binding, crystallin |
| Identity: |
2389 |
| Gene: |
CRYAB |
More about : CRYAB |
| Long gene name: |
crystallin alpha B |
| Synonyms gene: |
CRYA2 |
| Synonyms gene name: |
alpha B , crystallin |
| Synonyms: |
HSPB5 |
| Locus: |
11q23, 1 |
| Discovery year: |
1987-09-11 |
| Entrez gene record: |
1410 |
| Pubmed identfication: |
8431633 |
| Classification: |
Small heat shock proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000166885 |
| Locus Specific Databases: |
LOVD - Leiden Open Variation Database LRG_407 |