Recombinant Human Carbonic Anhydrase 4, CA4 (C-6His)

Contact us
Catalog number: C109
Price: 232 €
Supplier: novo
Product name: Recombinant Human Carbonic Anhydrase 4, CA4 (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Carbonic Anhydrase 4 is produced by our E, coli expression system and the target gene encoding Ala19-Lys283 is expressed with a 6His tag at the C-terminus
Molecular Weight: 31, 43 kD
UniProt number: P22748
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CA4 (C-6His), Carbonic Anhydrase 4
Short name: CA4 (C-6His), Recombinant Carbonic Anhydrase 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CA4 (C-6His), sapiens Carbonic Anhydrase 4, recombinant H
Alternative technique: rec
Identity: 1375
Gene: CA4 | More about : CA4
Long gene name: carbonic anhydrase 4
Synonyms gene: RP17
Synonyms gene name: retinitis pigmentosa 17 (autosomal dominant) carbonic anhydrase IV
Synonyms: CAIV Car4
Locus: 17q23, 1
Discovery year: 1992-04-07
GenBank acession: L10955
Entrez gene record: 762
Pubmed identfication: 8325641
RefSeq identity: NM_000717
Classification: Carbonic anhydrases
Havana BLAST/BLAT: OTTHUMG00000179987

Related Products :

C109 Recombinant Human Carbonic Anhydrase 4, CA4 (C-6His) 50 µg 496 € novo human
CC15 Recombinant Mouse Carbonic Anhydrase 4, CAIV, CA4 (C-6His) 1 mg 2486 € novo mouse
RP-0196H Recombinant Human Carbonic Anhydrase IV / CA4 Protein (His Tag) 10μg 572 € adv human
MBS624510 CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623542 CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
abx573558 Anti-Human Carbonic Anhydrase IV (CA4) ELISA Kit 96 tests 789 € abbex human
DL-CA4-Hu Human Carbonic Anhydrase IV CA4 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc407180bf Anti- Carbonic Anhydrase IV (CA4) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc595b3186 Anti- Carbonic Anhydrase IV (CA4) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc5960fbd4 Anti- Carbonic Anhydrase IV (CA4) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdca2949486 Anti- Carbonic Anhydrase IV (CA4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdca29b6b7b Anti- Carbonic Anhydrase IV (CA4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd2a80719f Anti- Carbonic Anhydrase IV (CA4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd8b08bda7 Anti- Carbonic Anhydrase IV (CA4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddaf0bc13b Anti- Carbonic Anhydrase IV (CA4) Antibody 100ug 575 € MBS Polyclonals human
EKU02921 Carbonic Anhydrase IV (CA4) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
AE61578MO-48 ELISA test for Mouse Carbonic anhydrase 4 (CA4) 1x plate of 48 wells 373 € abebio mouse
AE61578MO-96 Mouse Carbonic anhydrase 4 (CA4) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GENTAUR-58ba63bc19ec6 Rat Carbonic anhydrase 4 (Ca4) 100ug 1779 € MBS Recombinant Proteins rat
GENTAUR-58ba63bd007ea Rat Carbonic anhydrase 4 (Ca4) 1000ug 1779 € MBS Recombinant Proteins rat
GENTAUR-58ba63bd56383 Rat Carbonic anhydrase 4 (Ca4) 100ug 2293 € MBS Recombinant Proteins rat
GENTAUR-58ba63bdc632b Rat Carbonic anhydrase 4 (Ca4) 1000ug 2293 € MBS Recombinant Proteins rat
C107 Recombinant Human Carbonic Anhydrase 1, CA1 (C-6His) 10 µg 110 € novo human
C305 Recombinant Human Carbonic Anhydrase 10, CA10 (C-6His) 1 mg 2283 € novo human
CE99 Recombinant Human Carbonic Anhydrase 10, CA10 (N-6His) 500 µg 1613 € novo human
C108 Recombinant Human Carbonic Anhydrase 13, CA13 (C-6His) 1 mg 2283 € novo human
CG12 Recombinant Human Carbonic Anhydrase 14, CA14 (N-6His) 500 µg 1755 € novo human
CF26 Recombinant Human Carbonic Anhydrase 3, CA3 (C-6His) 50 µg 339 € novo human
C110 Recombinant Human Carbonic Anhydrase 5B, CA5B (C-6His) 500 µg 1613 € novo human
C111 Recombinant Human Carbonic Anhydrase 7, CA7 (C-6His) 50 µg 232 € novo human